KEGG   Geobacter metallireducens: Gmet_2766Help
Entry
Gmet_2766         CDS       T00295                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 protein, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gme  Geobacter metallireducens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_2766 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gmet_2766 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Gmet_2766 (sucB)
Enzymes [BR:gme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gmet_2766 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3125564..3126820)
Genome map
AA seq 418 aa AA seqDB search
MEIKVPSVGESVYEALVGKWLKKNGEAVRKDEPVCEIETDKITMEIDAGADGVLTIMVPE
GATVKIGSVIGIIEAGTGDRGPGTGKGKEVPPLSPAVRKIAQELGIKPETVHGSGRGGRV
TVDDLLTAGTRDLTAGTGDRGPGTGKGGEVPKDAAVKSGEAAAVGGKQKEFAFEPVPGPR
SPVPAAERVTRSPMTPIRKRIAERLLVARQQTAMLTTFNEADLGRVMELRKKYKEHFQKK
HGVSLGFMSFFVKACVEALKEYPAVNGSIEGDDIVFHHYYHIGIAIGAEKGLVVPVLRDA
DRLSFAEIETTIAGFAEKTKANRLELSDLQGGTFTISNGGVYGSLLSTPILNPPQSGVLG
MHAVQERPVVRDGQIVIRPMMYLALSYDHRIIDGREAVGFLKKVKEYVEEPEELFLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaggttccgtcagtgggcgaatcggtctacgaggcactggtggggaagtgg
ctgaaaaagaacggcgaggcggtccggaaggacgagccggtctgcgagatcgagaccgac
aagatcaccatggagatcgacgccggggccgacggtgtgctcaccatcatggtgccggaa
ggggccacggtgaagatcggctccgtcatcggcattatagaagccgggaccggggaccgg
ggaccggggaccgggaaaggcaaggaggtgcctccactgtcgccggcggttcgcaagatt
gcccaggagctggggattaagccggaaactgtccatggaagcggccggggcgggcgggtg
acggtggatgatctcttaacggccgggaccagggacttgacagccgggacgggggaccgg
ggaccggggaccgggaaaggcggggaagtgccgaaggatgctgcggtgaaatcgggtgaa
gcggcggcggttgggggtaagcagaaagaatttgcttttgagccggtccccggtccccgg
tccccggtccccgcggcagagcgcgttacgcgctcgccgatgacccccatccgcaaacgg
atcgccgagcggctcctggtggcccggcagcagaccgccatgctcaccacgttcaacgag
gcggatctgggccgggtgatggaactgcggaagaagtacaaggagcatttccagaagaag
cacggcgtctccctcggtttcatgtcgttcttcgtgaaggcgtgcgtggaggccctgaag
gagtatccggcggtgaacggctccatcgagggggatgacatcgtcttccaccactactac
catatcggcatcgccattggggccgagaaggggctcgtggtgccggtgctccgggacgcc
gaccggctctcctttgccgagatcgagacgaccatcgccgggttcgcggaaaagaccaag
gccaaccggctggagctgtcggatctccagggggggactttcaccatctccaacggcggg
gtctacggctcgctcctctccactcccattctcaacccgccccagagcggcgtcctcggc
atgcacgccgtccaggagcgccccgtggtccgcgacggccagatcgtcatacgtcccatg
atgtacctggccctctcctacgaccaccggatcatcgacggccgcgaggcggtcgggttc
ctgaagaaggtgaaggagtatgtggaagagcccgaggaactcttccttgaagggtag

DBGET integrated database retrieval system