KEGG   Geobacter metallireducens: Gmet_2821Help
Entry
Gmet_2821         CDS       T00295                                 

Gene name
hpnA
Definition
NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gme  Geobacter metallireducens
Brite
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Gmet_2821 (hpnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3193957..3194943
Genome map
AA seq 328 aa AA seqDB search
MKVFVTGATGFIGASIARELLKDGCHVRVLARPGSDRRNLDGLDVEVCEGDLCSPESLDR
GVKGCEVLYHAAADYRLWTRNPAAMYAANVEGTRHVLDAALRHGVSRVVYTSSVGTLGNP
GDGTPGTEATPVTFADMVGDYKKSKFLAEREAETFLARGLPLVIVNPSTPVGPHDVKPTP
TGKIIVDFLNRAMPAYLDTGLNIIDVEDCAQGHILAAQHGRIGEKYILGHENLTLRQIFS
LLETVTGLAAPKVRLPYLPILAAAYANEALSRITGREPLIPLAGVQMARKFMYFDSSKAV
KELGLPQRPAVEALGRAVEWFRANGYVR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttcgttaccggcgcaaccggcttcataggcgctagcatagcaagggaactg
ctgaaggacggctgccatgtcagggttctggcccggcccggctccgacaggcgcaatctc
gatggcctcgatgtggaagtgtgcgagggggacctctgttccccggaatccctggaccgg
ggggtcaaggggtgcgaggtcctctaccacgccgcggccgactaccgcctctggacccgc
aaccccgccgccatgtacgccgccaacgtggagggaacccgccacgtcctggacgcggcc
ctgcggcacggggtatcccgggtcgtctacacgagcagcgtcgggaccctgggaaatccc
ggcgacggcacccccggcacggaagccacccccgtcaccttcgccgacatggtgggggac
tacaagaaaagcaaatttctggcggaacgggaggctgagacgttcctggcccggggactc
cccctggtcatcgtgaatccctcgaccccggtgggcccccacgacgtgaaaccgactccc
accggaaagatcatcgtcgatttcctcaaccgcgccatgcccgcctacctggacacgggg
ctcaacatcatcgacgttgaggactgcgcccagggacacatcctggcggctcagcacggc
agaatcggcgagaagtacatcctcggccacgagaatctgacgttgcggcagatattctct
ctcctcgaaacggttacgggactcgcagcgccgaaggtgcgcctcccctacttacctatc
ctcgcagccgcctacgcaaacgaggccctgtcgcggatcaccggcagggagcccctcatc
ccgctggcaggggtgcagatggccagaaaattcatgtatttcgattcgtccaaggcggtg
aaggaactggggcttccccagcgcccggccgtcgaagccctggggcgtgcggtggaatgg
ttccgcgccaacggatatgtacggtaa

DBGET integrated database retrieval system