KEGG   Geobacter metallireducens: Gmet_2826Help
Entry
Gmet_2826         CDS       T00295                                 

Gene name
cheB64H-2
Definition
protein glutamate methylesterase CheB associated with MCPs of classes 40H and 40+24H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gme  Geobacter metallireducens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:gme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gmet_2826 (cheB64H-2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Gmet_2826 (cheB64H-2)
Enzymes [BR:gme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Gmet_2826 (cheB64H-2)
Two-component system [BR:gme02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Gmet_2826 (cheB64H-2)
Bacterial motility proteins [BR:gme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Gmet_2826 (cheB64H-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3202945..3203508)
Genome map
AA seq 187 aa AA seqDB search
MPLPNLAVIGASTGGLKVFESLFPHLPVLNAGVVIVQHIVPLVDRSFVTSLQRVSAMPVA
LARDGDAIRHGTVYLAPGALHLHLVANQTIRLAAGEKVNSVCPSIDVTMESVIPKPGARM
AGVILTGMGHDGADGIAHMKRCGAVTIAQDRATSVIYGMPKAAEATGMIDFVLSAERIAD
KLAELFK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccattgcccaacctggcggtcataggggcatcgacgggaggactcaaggtgtttgag
tcgctgtttccccatcttccggtcctcaatgccggtgtcgtgatcgttcagcacatcgtc
ccgctcgtcgaccggtcctttgtcacttccctgcagagggtctccgccatgcccgttgcg
ctggcacgggatggcgatgccatacgccatggcaccgtctacctggcgccgggagcgctt
cacctgcaccttgtcgccaatcagaccatacgccttgcagccggcgagaaggtcaactcc
gtctgcccgtccattgacgtcaccatggagagcgtcattccgaaacccggcgcccggatg
gccggcgtcatcctgaccgggatgggccatgacggtgccgacggcatcgcccacatgaaa
cgatgcggagcagtgaccattgcccaggacagggcgacgagcgtcatctatggcatgccc
aaggctgccgaggccacggggatgatcgactttgtcctttccgccgaacgaattgccgac
aaacttgccgagctctttaaataa

DBGET integrated database retrieval system