KEGG   Geobacter metallireducens: Gmet_2849Help
Entry
Gmet_2849         CDS       T00295                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gme  Geobacter metallireducens
Pathway
gme00900  Terpenoid backbone biosynthesis
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gmet_2849 (ispE)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Gmet_2849 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABB33067
JGI: Gmet2849
UniProt: Q39RQ7
Position
complement(3226921..3227766)
Genome map
AA seq 281 aa AA seqDB search
MKSLTLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDEITITLSDTSGVRVTCGREG
VPDGPENIAWRAANALLALSGLETGIDIAITKNIPVAAGLGGGSSDAATVLLGVNELLGL
GLSIERLMEVGVTLGADVPFFVFGKTALAEGIGEVLTAIDAVPPLWLVIVNPNIPVSTAW
VYQSLRLTGEWNGDTIPRFFKDVADVCAVLANDLELVTIERYPVIGEIKERLVAAGAAGA
LMSGSGPTVFGLFASEEEARGAAQSITNSSDWFVVAVRALV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctgacgctcaaggcccccgccaaggtcaactaccggctcgacgtgctccgc
cgtcggcctgacggctaccacgacctccggatgatcatgcagcggatcgatctctgcgac
gagattacgattactttgtccgacacttccggtgtccgggtcacctgtggccgcgaaggg
gtacccgacggtccggaaaacatcgcttggcgggccgccaacgcgcttctggctctctcc
gggctggaaacggggatcgatatcgccattaccaagaacatccccgttgctgccgggctt
ggcggcgggagcagcgacgcggccacggttcttctgggggtgaacgaacttctgggactc
ggcctctccatcgagcggctcatggaggtcggcgtgacgctgggtgccgacgtgccgttc
ttcgtcttcggcaagacggccttggccgaggggattggggaagtactcacggcaatagac
gccgtcccacccctctggcttgtgatcgttaaccccaatattccggtgtcgactgcctgg
gtgtaccaaagtttacggttgacaggtgagtggaatggcgatactattcctcgcttcttt
aaggatgtagcggatgtctgtgccgtcctcgccaatgatctcgaattggtgaccatcgag
cggtatccggtaatcggtgaaatcaaggagcgactggtcgccgcaggggctgctggggca
cttatgtccggcagtggtcccacggttttcggacttttcgcttccgaggaggaggcacgt
ggcgcggcccagtccattaccaattcatccgactggttcgtagtggcagtcagggctttg
gtgtga

DBGET integrated database retrieval system