KEGG   Geobacter metallireducens: Gmet_2907Help
Entry
Gmet_2907         CDS       T00295                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase, selenocysteine-containing
  KO
K01008  
selenide, water dikinase [EC:2.7.9.3]
Organism
gme  Geobacter metallireducens
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Gmet_2907 (selD)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Gmet_2907 (selD)
Transfer RNA biogenesis [BR:gme03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Gmet_2907 (selD)
 Prokaryotic Type
    Gmet_2907 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3290478..3291509)
Genome map
AA seq 343 aa AA seqDB search
MIKLTSLVKAAGUAAKLGPAGLEDALSGILGKGDDPNLLVGPETADDAGVYRIGEGLALV
DTVDIITPLVDDPFTFGRIAAANALSDVYAMGGRPVTAMNLAFFPACTLPGQILADIMAG
GLDAVREAGACLVGGHTVEDHELKYGLSVTGLISPGRIVRNSTARPGDRLILTKPLGTGI
VSTAIKADMVAPGVVDEAIRWMALLNASAAGLMLECEASACTDVTGFGLLGHACEMARGA
GVTLEIALDAVPLMGGVEDLVADGLVPAGCYRNRDHYTPLVSVSAGAGGRLIPLFDPQTS
GGLLITLSPQFADSFLSMARDRGLFAVAVGGVLPPREHAVVIA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgacatccctcgtaaaagcggccggctgagcggccaagctgggcccggcg
ggcctggaagacgcactgagcggcatcctggggaagggagacgatccgaacctcctcgtg
gggccggagaccgccgacgacgcgggggtctaccggataggggaggggctcgccctggtg
gatacggtggatatcatcacccccctggtggatgacccgttcactttcggccggattgcg
gcggccaacgccctctccgatgtctacgccatgggtggaaggccggtgaccgccatgaac
ctggccttcttcccggcctgcaccctgccgggacagatcctggccgacatcatggccggt
ggccttgacgcggtgcgggaggcgggggcctgcctcgtgggggggcacacggtggaggac
cacgagctgaaatacggtctctcggtcaccggtctcatcagccccgggcggatcgtgcgc
aactccacggcccgccccggcgacaggctcatcctcaccaagcccctggggacggggata
gtctccacggccatcaaggccgacatggttgcacccggcgttgtcgacgaagcgatccgc
tggatggcgctcctgaacgcttcggctgcggggctcatgctggaatgcgaggcttccgcc
tgcaccgatgtcaccggtttcggccttctggggcatgcctgcgagatggcccggggagcc
ggcgttaccctcgaaatcgcccttgacgccgttcccctcatgggaggagtcgaggacctt
gtggccgatggcctcgtgccggccggctgctaccgcaaccgcgatcactataccccctta
gtctccgtttccgccggggcgggaggccggctcatccccctcttcgacccccagacctcc
ggggggctcctcatcaccctttcgccgcaattcgccgactccttcctctccatggcccgg
gaccgagggctctttgccgtcgccgtgggtggggttctccctccccgggagcatgccgtt
gtcatcgcctga

DBGET integrated database retrieval system