KEGG   Geobacter metallireducens: Gmet_3091Help
Entry
Gmet_3091         CDS       T00295                                 

Gene name
macA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gme  Geobacter metallireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3492846..3493886
Genome map
AA seq 346 aa AA seqDB search
MERKAIACAAVLALVVGTAWGKDDVMGRAKGIFKPIPAKAKALKGNPATPAKVELGKMLY
FDPRLSSSQLISCNTCHNVGLAGADLQETAIGHGWQKGPRNSPTVLNAVYNIAQFWDGRA
EDLAAQAKGPVQASVEMNNKPENLVATLKSIPGYQPLFRKAFPGEKDPVTFDNVAKAIEV
FEATLVTPDAPFDRYLNGNKKALTAAEEQGLALFLDKGCVACHSGINVGGTGYFPFGVKE
SPGPEIRPEGDTGRFKVTNTAADKYVFRSPSLRNAAITMPYFHSGKVWALKDAVKIMGGA
QLGISLTDDDAGKITAFLGSLTGKQPKVMHPILPPNSDTTPRPMTN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaggctattgcatgtgcggccgtactcgccctggttgtcggaacggcctgg
ggcaaggatgatgtcatgggacgggccaagggaattttcaagccgattcccgccaaggcc
aaggcattgaaggggaacccggccacgccggcaaaggtagagctggggaagatgctctac
ttcgacccgcggctctcgtcgtcgcagctcatcagctgcaatacctgtcacaatgtgggg
ctggccggcgccgacctccaggagaccgccatcggccacggctggcagaagggtccccga
aactcacccacggtcctgaacgccgtttacaacatcgcccagttctgggacggccgggcc
gaggacctggcggcccaggccaaggggccggtccaggcgtccgttgagatgaacaacaaa
cccgagaacctggtggcgaccctcaagagcatccccggctaccaacccctgttcaggaag
gccttccccggcgaaaaagaccctgtcaccttcgacaacgtggccaaggccatcgaggtt
ttcgaggcgaccctcgtcaccccggacgcccccttcgacaggtacctgaacgggaacaag
aaagccctgactgccgccgaagagcaggggctcgccctctttctcgacaagggatgcgtc
gcctgccacagcggcatcaacgtgggggggaccggctacttccccttcggcgtcaaggaa
agcccgggccccgaaatccgccccgagggggacaccggccggttcaaggtgaccaacacg
gcggctgacaagtacgtcttccggtcgccgagcctgcgcaacgcggccatcaccatgccc
tacttccactcgggcaaggtctgggcgctgaaggatgccgtcaagatcatgggaggcgcc
cagctcggcatctccctcaccgacgacgacgccggcaagatcaccgcgttcctggggagc
ctcaccggcaagcaaccgaaggtcatgcacccgatcctgccccccaactccgacaccacg
ccacgccccatgacgaactga

DBGET integrated database retrieval system