KEGG   Geobacter metallireducens: Gmet_3420Help
Entry
Gmet_3420         CDS       T00295                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gme  Geobacter metallireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gmet_3420 (recR)
DNA repair and recombination proteins [BR:gme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Gmet_3420 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3837754..3838347)
Genome map
AA seq 197 aa AA seqDB search
MLQSSNSFARLLAELQKLPGVGEKTALRLAFHLLKYPENTAALAESLGEVLSRVKFCSVC
FGITEEDPCRLCSSDRDETSLCVVEEPQDLLAVERTRAFRGRYHVLQGALSPLNGVTPDR
LRIAELMRRLEEGTVREVVIATNFSVEGETTALYLARQIKPLGIRVTRLAHGIPLGSDLE
YVDAATVQRALEGRSEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctacagtcctcaaactcgtttgcgcggctccttgcggagctgcagaaattgccgggt
gttggtgagaaaaccgcgttgcggctcgcgtttcacctgcttaaatacccggagaatacc
gcagcccttgctgagagcctcggcgaggtgctgagccgggtgaaattttgttccgtctgc
ttcggcatcaccgaggaagatccctgccggctctgcagcagcgaccgcgacgagacgtcc
ctttgtgttgtcgaggaaccccaggacctcctggcggtggagaggacccgggccttccgg
ggacgttaccacgtccttcagggggccctgtcgccgttgaacggggtcactcccgaccgg
ctccggatcgccgaactgatgcggcggctcgaagagggtacggtgcgggaggtggtcatt
gccaccaacttctccgttgagggggaaacgacggccctctatcttgcgcggcagatcaag
ccccttggcatcagggtcacgcggcttgcccacggcatccccctggggagcgatctggag
tatgtggacgcggccacggtgcagcgggcccttgagggacggagcgaattgtag

DBGET integrated database retrieval system