KEGG   Geobacter metallireducens: Gmet_3551Help
Entry
Gmet_3551         CDS       T00295                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gme  Geobacter metallireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gmet_3551 (hemY)
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Gmet_3551 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3986026..3987435
Genome map
AA seq 469 aa AA seqDB search
MKKVIVVGGGISGLATAFELRNKGAEAGIELDVTLLEKEERVGGKIWSIKEEGYLCEWGP
NGFLDSKPQTLDLCRDLGASERLLRSNDNARKRFIYTGGVLNRLPENGPTFLKSSLISWP
GKLRLAMEPFISKRTDGTDETLASFGRRRLGEEALQKLISPMVSGIFAGDPETMSLRSCF
PRIAELEDEYGSLIKAMIKLAKKKKQEAAQGKAVSSAAGPGGVLTSFRWGIQELTDILAE
QLGSATVVTGQPVTGLTRGSSVPWRLKTPTVDIDADVVILASPAHATAGIVSGVDAAMAQ
VLGEIPYASMTVVCFGFERERIAYDLNGFGYLIPKDEGMNTLGTLWDSSIFENRAPEGKV
LLRSMLGGACFPEYVKLSDAEVMQRVKADLKATMGITADPSFIRIFRHPQAIPQYTVGHG
KRLAALQERSSALPGLFLTGNSYRGIGLNDCATAANRTTDEVVAYLKGR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttatcgtggtggggggcggcatttctgggctcgcaaccgcctttgagctg
cgcaataaaggagcagaggcgggcatcgagctggatgtgaccctgctggaaaaggaagag
cgggtcggcggcaagatctggagcatcaaggaggagggatacctctgcgagtgggggccc
aacggctttctggactccaagccccagaccctcgacctctgccgggacctgggtgcctcg
gaaaggctcctgcggagtaacgataacgcccgtaagcgcttcatctacaccgggggcgtt
ctgaaccggctccccgagaacggccccacgtttctcaagagcagcctcatctcgtggccc
ggcaaactccgcttggcaatggaacccttcatctcgaagcggaccgacggcaccgacgag
accctcgcctcctttggccgccggcgcctcggcgaggaggccctccagaagctcatctcc
cccatggtgtcggggatcttcgccggcgacccggaaaccatgtcgctccgctcctgcttc
ccccgcatcgcggaactggaggacgaatacggtagcctcataaaagccatgatcaaactg
gcgaaaaagaagaagcaggaagcggcccagggaaaggcggtatcgagcgccgccggcccc
ggtggagtcctcacctctttccgatgggggatccaggagctgaccgacatcctggcggag
cagctcggttccgcgaccgtggttacgggtcagcccgtgacgggcttgaccaggggatcg
agcgtcccgtggcggctgaagacacccaccgtcgatatcgacgccgacgtggtgattctc
gcctcgccggcccatgccaccgccggcatcgtcagcggcgttgacgccgccatggcccag
gtgctgggggagatcccctacgcctccatgaccgtggtctgcttcggcttcgaacgggag
cggatcgcctacgacctgaacggcttcggctacctgatccccaaggatgaggggatgaac
accctcggtaccctctgggactccagcatcttcgaaaaccgtgccccagagggtaaggtg
ttactgcggagcatgctcggcggcgcctgcttccccgagtacgtgaaactttccgacgcg
gaggtgatgcagcgggtgaaggcagatctcaaggcgaccatgggaatcacggcggacccc
tccttcatcaggatcttccgccatccccaggccatcccccagtacaccgtcggccacgga
aagcgcttggcggccctccaggaacgctcctcggccctcccggggctcttccttaccgga
aactcctaccgcggcatcggcctcaacgactgcgccaccgccgccaaccgcaccaccgac
gaggtggtggcctatctgaagggccgatag

DBGET integrated database retrieval system