KEGG   Geobacter metallireducens: Gmet_3551Help
Entry
Gmet_3551         CDS       T00295                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gme  Geobacter metallireducens
Pathway
gme00860  Porphyrin and chlorophyll metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gmet_3551 (hemY)
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Gmet_3551 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Gmet_3551 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 FAD_binding_2 HI0933_like FAD_binding_3 Thi4 MCRA Pyr_redox FAD_oxidored Trp_halogenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABB33756
JGI: Gmet3551
UniProt: Q39PR8
Position
3986026..3987435
Genome map
AA seq 469 aa AA seqDB search
MKKVIVVGGGISGLATAFELRNKGAEAGIELDVTLLEKEERVGGKIWSIKEEGYLCEWGP
NGFLDSKPQTLDLCRDLGASERLLRSNDNARKRFIYTGGVLNRLPENGPTFLKSSLISWP
GKLRLAMEPFISKRTDGTDETLASFGRRRLGEEALQKLISPMVSGIFAGDPETMSLRSCF
PRIAELEDEYGSLIKAMIKLAKKKKQEAAQGKAVSSAAGPGGVLTSFRWGIQELTDILAE
QLGSATVVTGQPVTGLTRGSSVPWRLKTPTVDIDADVVILASPAHATAGIVSGVDAAMAQ
VLGEIPYASMTVVCFGFERERIAYDLNGFGYLIPKDEGMNTLGTLWDSSIFENRAPEGKV
LLRSMLGGACFPEYVKLSDAEVMQRVKADLKATMGITADPSFIRIFRHPQAIPQYTVGHG
KRLAALQERSSALPGLFLTGNSYRGIGLNDCATAANRTTDEVVAYLKGR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttatcgtggtggggggcggcatttctgggctcgcaaccgcctttgagctg
cgcaataaaggagcagaggcgggcatcgagctggatgtgaccctgctggaaaaggaagag
cgggtcggcggcaagatctggagcatcaaggaggagggatacctctgcgagtgggggccc
aacggctttctggactccaagccccagaccctcgacctctgccgggacctgggtgcctcg
gaaaggctcctgcggagtaacgataacgcccgtaagcgcttcatctacaccgggggcgtt
ctgaaccggctccccgagaacggccccacgtttctcaagagcagcctcatctcgtggccc
ggcaaactccgcttggcaatggaacccttcatctcgaagcggaccgacggcaccgacgag
accctcgcctcctttggccgccggcgcctcggcgaggaggccctccagaagctcatctcc
cccatggtgtcggggatcttcgccggcgacccggaaaccatgtcgctccgctcctgcttc
ccccgcatcgcggaactggaggacgaatacggtagcctcataaaagccatgatcaaactg
gcgaaaaagaagaagcaggaagcggcccagggaaaggcggtatcgagcgccgccggcccc
ggtggagtcctcacctctttccgatgggggatccaggagctgaccgacatcctggcggag
cagctcggttccgcgaccgtggttacgggtcagcccgtgacgggcttgaccaggggatcg
agcgtcccgtggcggctgaagacacccaccgtcgatatcgacgccgacgtggtgattctc
gcctcgccggcccatgccaccgccggcatcgtcagcggcgttgacgccgccatggcccag
gtgctgggggagatcccctacgcctccatgaccgtggtctgcttcggcttcgaacgggag
cggatcgcctacgacctgaacggcttcggctacctgatccccaaggatgaggggatgaac
accctcggtaccctctgggactccagcatcttcgaaaaccgtgccccagagggtaaggtg
ttactgcggagcatgctcggcggcgcctgcttccccgagtacgtgaaactttccgacgcg
gaggtgatgcagcgggtgaaggcagatctcaaggcgaccatgggaatcacggcggacccc
tccttcatcaggatcttccgccatccccaggccatcccccagtacaccgtcggccacgga
aagcgcttggcggccctccaggaacgctcctcggccctcccggggctcttccttaccgga
aactcctaccgcggcatcggcctcaacgactgcgccaccgccgccaaccgcaccaccgac
gaggtggtggcctatctgaagggccgatag

DBGET integrated database retrieval system