KEGG   Glycine max (soybean): 100037445Help
Entry
100037445         CDS       T01710                                 

Gene name
UOX, N-35
Definition
nodulin 35 (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
gmx  Glycine max (soybean)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100037445 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100037445 (UOX)
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100037445 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 309 aa AA seqDB search
MAQQEVVEGFKFEQRHGKERVRVARVWKTRQGQHFVVEWRVGITLFSDCVNSYLRDDNSD
IVATDTMKNTVYAKAKECSDILSAEDFAILLAKHFVSFYKKVTGAIVNIVEKPWERVIVD
GQPHEHGFKLGSEKHTTEAIVQKSGSLQLTSGIEGLSVLKTTQSGFVNFIRDKYTALPDT
RERILATEVTALWRYSYESQYSLPQKPLYFTEKYQEVKKVLADTFFGPPNGGVYSPSVQN
TLYLMAKATLNRFPDIAYVSLKMPNLHFLPVNISNKDGPIVKFEDDVYLPTDEPHGSIQA
SLSRLWSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaggaagtggtagaagggttcaagttcgaacagaggcacgggaaagagcgc
gtgagagtggcgcgcgtgtggaagacgaggcaggggcagcacttcgttgtggagtggcgc
gtgggcatcactctcttctcagactgcgtcaactcgtatctccgcgatgacaactctgac
atcgttgctactgataccatgaaaaacacagtgtatgcaaaagcaaaggaatgctcagac
atactttctgctgaggactttgctattttgcttgctaagcactttgtatcattttacaag
aaggttactggtgctattgtgaatattgtggaaaaaccatgggagcgtgtcattgtggat
ggtcaacctcatgaacatggtttcaaacttgggtctgagaagcatacaacagaggcaata
gtacaaaagtctggttcacttcagttgacttctggtattgaaggattgtcagtgttgaag
acaacccagtctggttttgtgaatttcataagagacaagtacacagcacttcctgatacc
cgtgaaaggattctggcaacagaagtaaccgcactgtggaggtattcgtatgaatcacag
tatagcctccctcagaagccactttactttacagaaaagtatcaggaagtgaaaaaagtt
ctggctgacactttttttggcccaccaaatgggggagtctatagcccatctgttcaaaac
acactctacctgatggcaaaggccacactgaacagatttcctgacatagcttatgtcagt
ctaaagatgccaaatcttcatttcttacctgtcaatatctcaaacaaggatggtcctatt
gtgaagtttgaggatgatgtgtacttgccaacggatgagcctcatgggtcaattcaagct
agcttgagccgcctttggtcaaagctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system