KEGG   Glycine max (soybean): 100037460Help
Entry
100037460         CDS       T01710                                 

Definition
phosphatidylinositol-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gmx  Glycine max (soybean)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:gmx00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:gmx04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 600 aa AA seqDB search
MTSKQTYSVCFCWRRRFKLALAEAPSEIKTLFEEYSENEFMTPSHLKRFLVEVQRQEKAT
EEDAQAIIDSFRHFPRRGAGLNLETFFKYLFSDDNPPLLPSHGVHHDMTLPLSHYFIYTG
HNSYLTGNQLSSDCSDVPIINALKRGVRVIELDIWPNASKDNIDVLHGRTLTTPVELIRC
LRSIKDHAFVASEYPVVITLEDHLTPDLQAKVAEMVTETFGDLLFTPNSESVKEFPSPES
LKKRIIISTKPPKEYLEAKEKEKGDDSQHEKEKGDDSQHGKALGEDEAWGKEVPSLKGGT
IEDYKDYNVDEDLNDEEEFDESDKSHHNEAPEYRRLIAIHAGKPKGGLAECLKVDPDKVR
RLSLSEQQLEKAAINHGQQIVRFTQRNILRVYPKGTRIDSSNYNPLIGWMHGAQMVAFNM
QGYGRSLWLMHGMFRANGGCGYVKKPNFLLETGPDDEVFNPKAKLPVKTTLKVTVYMGEG
WYYDFKHTHFDQYSPPDFYTRVGIAGVPNDTIMKRTKAIEDNWLPTWNEVFEFPLTVPEL
ALLRIEVHEYDMSEKDDFGGQACLPIWELRSGIRAIPLHSQKGDKYNTVKLLMRFEFINN
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgaagcagacatacagcgtgtgcttctgctggcgacggcggttcaagctggcg
ctggcggaggcgccgtcggagatcaagaccctcttcgaggagtactccgagaatgagttc
atgacaccttcgcatctcaaaaggtttctcgtggaagtgcaaaggcaagagaaggccacc
gaagaagacgcgcaagccatcatcgacagcttcaggcatttccctcgcagaggcgctggc
ctcaatctcgaaactttcttcaagtacctcttcagtgacgataacccccctcttcttcct
tctcatggggtgcatcatgatatgactttacccttgtcacattatttcatatatacaggc
cataattcatatttaactgggaatcagctgagcagcgactgcagtgacgtccccatcata
aatgcactgaagagaggtgtgcgggtgattgaattggacatatggcctaatgcatcaaag
gataacatagatgttcttcatggaaggacattgactactcctgtagagctcataagatgt
ttgaggtctattaaggatcatgcctttgtggcatcagaatatccagttgtaataacccta
gaagaccaccttacgccagatctccaggctaaagtggctgagatggttactgaaacattt
ggagacttactatttactcctaactcagaaagtgtgaaggaattcccttctcctgaatca
cttaaaaagagaattattatatcaaccaaaccacctaaggagtaccttgaggcaaaagaa
aaggaaaaaggggatgattcacagcacgaaaaggagaaaggggatgattcacagcatgga
aaggcattaggcgaagatgaagcttgggggaaggaagtcccaagcttgaaaggtggtact
atagaggattacaaggactacaatgtggatgaagatcttaatgatgaggaagaatttgat
gaatcagacaagtcacatcataatgaagctccagaatatagacgcctaattgcaattcat
gctgggaagcctaaaggtggattagcagaatgcctcaaagtggatcctgataaagtgaga
cgtctaagtttaagtgagcaacagcttgaaaaggctgccataaatcatggacaacaaatt
gtcaggtttactcagcggaatatactaagggtgtatccaaaaggtactcgcattgactca
tcaaattataacccattaattgggtggatgcatggagctcagatggttgcatttaacatg
caggggtatgggagatctctttggttgatgcatggaatgttcagagccaatggagggtgt
ggttatgttaaaaaaccaaattttctattggagactggtccagatgacgaggtcttcaat
cctaaagctaagttacctgtgaagactactttgaaggtgactgtatatatgggggaagga
tggtactatgatttcaagcatacacactttgatcaatattcacctccagacttctacaca
agagtggggattgctggagtccctaatgatactataatgaagagaactaaggcaatagag
gataactggttacctacatggaatgaggtattcgagttccctctcactgttccggagttg
gcgttgcttcgcatagaagttcatgagtatgacatgtctgagaaagatgactttggtgga
caagcatgcctacctatctgggagcttagaagtggcattcgagcaattccactgcatagc
caaaagggggataaatacaacactgtaaagcttctcatgcgctttgaatttattaataat
tga

DBGET integrated database retrieval system