KEGG   Glycine max (soybean): 100037469Help
Entry
100037469         CDS       T01710                                 

Gene name
PDK3
Definition
mitochondrial pyruvate dehydrogenase E1alpha-kinase 3
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100037469 (PDK3)
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100037469 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 367 aa AA seqDB search
MEVNIEKTLLMCKSFMKEVKIWGCLKQTGVSLRYMMEFGSNPTQKNLLISAQFLHKELPI
RIARRAIELHSLPHGLSHMPPVLKVRHWYLDSFREIISFPEIKNMNDEKEFTELIKAIKV
RHNNVVPTMALGVQQLKNVFEDPDEIDEFLDRFYMSRIGIRMLIGQHVELHNPNPPPNCV
GYIHTNMPPVNVARNASEDARSMCYREYGSAAEVRIYGDPDFTFPYVPAHLHLMVFKLVK
NSLRAVQERFMDSDEVAPPIRIIIADGIEDVTIKVSDEGGGIPRSGLPKIFTYLYSTAKN
SSSVEHEPSDIGTMENVTMAGYGYGLPICRLYARYFGGDLQVISMEGYGTDAYLHLSRLG
DSQEPLP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaacattgagaaaacgttgctaatgtgtaagagtttcatgaaagaggtaaag
atatggggttgtttgaagcagacaggggtcagcctgagatacatgatggagtttggttcc
aaccccactcagaagaatttgctcatttctgcacagttccttcacaaagagcttcccatt
agaattgcaaggagagccattgagcttcactctctccctcatggcttgtctcacatgcct
cctgtcttgaaggttagacattggtacttggattctttccgtgaaattatatctttccct
gagatcaagaatatgaatgacgagaaagaattcaccgaactgattaaggccatcaaggtg
agacacaacaatgtggtacctacaatggccttgggtgttcagcaattgaagaatgttttt
gaggatcctgatgagattgatgagtttcttgatcgcttttacatgtcaagaattggaatt
cgtatgctcatcgggcagcatgttgagttgcacaatccgaatcctcctcccaattgtgta
ggttatatacatacaaatatgcctcctgtgaatgtggcaaggaatgctagtgaggatgca
cgttctatgtgttatcgcgaatatggcagtgccgcagaagttcgcatttacggggatcct
gattttacttttccgtatgttccagctcacttgcatcttatggtatttaagttggttaag
aactcgctgcgtgctgtccaagagcgttttatggactctgacgaagttgctcctcccatt
agaataataatagcagatggaatagaggatgttaccataaaggtntcagatgagggaggt
ggaataccaaggagtggtctcccaaaaatttttacatatctctacagtacagccaaaaac
tcatcgtcagttgaacatgaaccttctgatattggaacaatggaaaatgtaactatggct
ggatatggttatggacttcctatttgccgcttgtatgctaggtattttggtggtgatctt
caagtaatctctatggaaggatatgggactgacgcatatctccatttgtctcgtttgggg
gattcgcaagaacctttgccctga

DBGET integrated database retrieval system