KEGG   Glycine max (soybean): 100037472Help
Entry
100037472         CDS       T01710                                 

Gene name
PDIS-2
Definition
protein disulfide isomerase-like protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100037472 (PDIS-2)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100037472 (PDIS-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 362 aa AA seqDB search
MWSSKTTMMLAIAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCK
RLAPEYEQLGASFKKTKSVLIAKVDCDEHKSVCGKYGVSGYPTIQWFPKGSLEPKKYEGA
RTAEALAAFVNIEAGTNVKIASVASSVVVLSPNNFDEVVFDETKDVLVEFYAPWCGHCKA
LAPIYEKVAAAFNLDKDVVIANVDADKYKDLAEKYGVSGYPTLKFFPKSNKAGENYDGGR
DLDDFVAFINEKCGTYRDGKGQLTSKAGIIASLDDLVKEFVSADSNEKKAVYSRLEEEVK
KLKGSSARHGDLYLKLAKKGMEKGADYAKNEIQRLERMLEKSVSPAKADEFTLKKNILSI
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctccaaaacgacgatgatgctggccattgcagccattgctctgatgatgttt
ctctcatcggcttcagccgacgacgtcgttgcactcacagaggaaaccttcgaaaacgag
gttggcaaggatcgcgccgctctcgttgagttttacgctccctggtgtggacactgtaaa
aggcttgccccggagtacgaacagctcggagcgagttttaagaaaacgaagtccgttttg
attgccaaggtggactgtgatgaacataaaagcgtttgcggtaaatatggggtatctggt
taccctaccattcaatggtttcctaagggatctctagaacctaaaaagtatgaaggtgca
cgtactgcagaagcccttgctgcgtttgtgaacattgaagcaggtacaaatgtgaagata
gcttctgttgcatccagtgtggtagttctctctccaaataactttgatgaggttgtcttc
gatgaaacaaaagatgttctggtggaattctatgcaccatggtgtggtcattgcaaggcc
cttgcccctatttatgaaaaagttgctgcagcatttaacctggataaagatgtagttata
gccaatgttgatgccgacaagtataaagatttggctgagaaatatggtgttagtggctat
cctacactgaagtttttcccaaagagcaacaaagctggtgaaaattatgacggtggccgt
gatttggatgattttgtagcattcatcaatgagaaatgtggtacctaccgtgatgggaag
gggcagcttacttctaaagctggtataatagcatctctggatgacttggtgaaggagttt
gtgagtgctgacagtaatgagaagaaggcagtatattcccggcttgaggaggaagttaag
aagcttaaaggttcttctgccagacatggcgacctttacttaaaacttgctaagaagggt
atggaaaagggtgcagactatgcaaagaatgaaattcaacgtcttgagcgcatgcttgag
aagtcagtcagcccagcaaaagcagatgaattcactctcaagaagaacatcttatctatc
tttgcttga

DBGET integrated database retrieval system