KEGG   Glycine max (soybean): 100101849Help
Entry
100101849         CDS       T01710                                 

Gene name
CEL2
Definition
endo-1,4-beta-glucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100101849 (CEL2)
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100101849 (CEL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 502 aa AA seqDB search
MHQSMKMKKVLRSLFQIAVFHVLLKPKAGLGSSHDYGDALSKAIIFFEGQRSGFLPEDQR
VSWRGKSGLSDGWNYNTDLTGGYYDAGDNVKFGFPMAFTTTMLAWSVLEFGDVMPPNELR
NALVAIRWATDYLLKTVSQPNRIFVQVGDPNSDHECWERPEDMDTARTTYAVDAPNAASD
VAGETAAALAAASMAFRSSDPGYSETLRRNAITAFQFADNYRGAYSDNDNVKYNACPYYC
DFDGYQDELLWGAAWLRRATQDDNFLNYIQTNGKTLGADDNINEFGWDNKHAGLNVLVSK
EVIEGNMYSLESYKSSAESFICTLIPESPSSHIEYTPGGLVYRPGGSNLQHATSIAFLEL
VYANYLTHASQAINCGNVYVSAQTLRQHAKRQVDYILGDNPMGLSYMVGYSNYYPQRIHH
RGSSLPSIKDHPQFIACKEGSIYYNSTNPNPNVLVGAIVGGPDENDDYVDDRVDFRKSEP
TTYINAPFVGVLAYFAANPNFS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaatcaatgaaaatgaagaaggtgttgaggagcttgttccaaattgcggttttt
catgtgttgttaaaaccaaaagcgggattggggagcagccacgactacggagacgcgttg
tcgaaggcgattattttcttcgagggacagcgatcgggattcctgccagaggatcagaga
gtgagttggcgagggaagtcggggctgagcgacgggtggaactacaacacggatctcacc
ggcggctactacgacgccggcgacaacgtcaaattcgggtttccgatggcctttaccacc
acaatgcttgcgtggagcgtgctcgaattcggtgacgtcatgcctcccaatgagctcagg
aacgccctcgtcgcaattcgttgggccaccgattatctcctcaagactgtttctcagccc
aatcggattttcgttcaggtgggtgatccaaactcagaccatgaatgttgggagagacca
gaggacatggatacagccaggactacgtatgctgttgatgcaccaaacgcggcttccgat
gtcgccggtgaaacagccgccgctctagccgccgcatccatggcattccggtcatcggac
ccgggttactcggagacattgcgtcgtaatgctattacagccttccaatttgcagataac
tacaggggtgcttacagtgacaatgataatgttaagtataatgcctgcccatattactgc
gattttgatggctatcaggatgagttgttatggggagccgcatggctaaggagggcgacg
caggacgataatttcctcaactacattcaaaccaatggcaaaactcttggtgccgacgac
aacatcaatgagtttggttgggacaacaaacatgctggcctcaacgtacttgtctctaag
gaagtcatagaaggaaacatgtactctcttgagtcctacaagtcctcagcagagagcttc
atttgcaccctcatacccgaatcaccaagctcacacatagagtacacgccaggtggactt
gtgtacagacccggaggcagcaacttgcaacatgcaacttcaattgctttccttgaattg
gtctatgccaattacctaacacacgcttcacaagccatcaattgtggcaatgtctatgtt
agtgcacaaacacttcgccaacatgctaagaggcaagttgattacattttgggtgataac
ccaatgggattatcctacatggttggctatagcaactactatccacaacgtattcatcac
cgtggatcttccttaccctccatcaaggatcatcctcagttcattgcatgcaaagaaggt
tcaatttattacaattccaccaatcccaatcctaatgttcttgttggtgccattgttgga
ggacctgacgaaaatgatgattatgtggatgatcgagttgattttaggaaatccgagcca
accacatacattaacgcaccatttgttggggttttagcatattttgctgctaatcccaac
tttagttaa

DBGET integrated database retrieval system