KEGG   Glycine max (soybean): 100127411Help
Entry
100127411         CDS       T01710                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
gmx  Glycine max (soybean)
Brite
Exosome [BR:gmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   100127411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 131 aa AA seqDB search
MSWQAYVDDHLLCEIEGNHLTHAAIIGQDGSVWAQSTNFPQFKPEEITAINNDFNEPGSL
APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
RLGDYLIDQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaagcgtatgtggatgatcacctactgtgtgaaatcgaaggtaaccacctc
actcacgccgctatcatcggccaagacggaagcgtttgggctcagagcaccaacttccct
cagttcaaacctgaggaaataactgccatcaataatgactttaatgagcctggatcactt
gctccaactggattgtatatcggtggcaccaaatacatggtcatccagggtgagcctggt
gctgtcattcgagggaagaagggtcctggtggtgttactgtgaagaagaccggtgcggcc
ttgatcattggcatttatgatgaaccaatgactccaggtcaatgcaacatggtagttgaa
aggcttggcgattatctcattgatcagggtctctaa

DBGET integrated database retrieval system