KEGG   Glycine max (soybean): 100170705Help
Entry
100170705         CDS       T01710                                 

Gene name
PDIL-1
Definition
(RefSeq) protein disulfide isomerase-like protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100170705 (PDIL-1)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100170705 (PDIL-1)
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100170705 (PDIL-1)
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100170705 (PDIL-1)
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100170705 (PDIL-1)
  Exosomal proteins of colorectal cancer cells
   100170705 (PDIL-1)
  Exosomal proteins of bladder cancer cells
   100170705 (PDIL-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 AhpC-TSA ERp29_N Glutaredoxin Redoxin TraF
Motif
Other DBs
NCBI-GeneID: 100170705
NCBI-ProteinID: NP_001238009
UniProt: I7FST9
Position
4
AA seq 525 aa AA seqDB search
MPKFFHSIFRGTMAGRVSTCFFFVFALSLLLPFQISAEESSEKEFVLTLDHSNFHDTVSK
HDFIVVEFYAPWCGHCKKLAPEYEKAASILSSHDPPVVLAKIDANEEKNKDLASQYDVRG
YPTIKILRNGGKNVQEYKGPREADGIVDYLKKQSGPASTEIKSADEATAFIGENKVAIVG
VFPKFSGEEFDNFSALAEKLRSDYDFGHTLNAKHLPRGESSVSGPVVRLFKPFDELFVDF
QDFNVEALEKFVEESSTPVVTVFNNDPSNHPFVAKFFNSPNAKAMLFINFTAEGAESFKS
KYREAAEQHKQQGVSFLVGDVESSQGAFQYFGLKEEQVPLIIIQHNDGKKFFKPNLEADH
IPTWLKAYKDGNVAPFVKSEPIPEANDEPVKVVVGNSLEDIVFKSGKNVLLEFYAPWCGH
CKQLAPILDEVAISYQSDADVVIAKLDATANDIPSETFDVQGYPTVYFRSASGKLSQYEG
GRTKEDIIEFIEKNRDKPAQQEQGQDKPAQQEQGQDEQEKGKDEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaattttttcatagcattttcagaggaacaatggcgggtagggtttcgacgtgc
ttcttcttcgtgtttgctctttctctccttcttccttttcagatctccgctgaggaatca
tcggagaaagagttcgtactcacattggatcactctaactttcacgacactgtcagcaag
cacgatttcatcgtcgtcgagttctacgctccatggtgtggccactgtaagaagcttgct
cccgagtatgagaaagctgcttctatcttgagtagtcatgatcctccggttgttttggct
aaaattgatgccaatgaggagaagaacaaagaccttgcatctcaatatgatgttagggga
tacccaacaattaagattctgagaaatgggggaaagaatgttcaggaatacaaaggtccc
cgtgaagcagatggcatcgttgactatttgaagaaacaaagtggtcctgcttcaactgaa
attaaatctgctgatgaagctactgctttcattggtgaaaataaagttgctattgttgga
gttttcccgaaattttctggagaggagtttgacaacttttctgccttagcagagaagttg
cgttctgactatgacttcggtcacactctgaatgccaaacaccttccaagaggagagtca
tcagtttctggtcccgtagttaggttgttcaagccattcgatgaactttttgttgacttc
caggatttcaatgtggaagctctagagaaatttgttgaggaatctagtacccctgttgtt
actgtctttaacaatgatccgagcaatcaccctttcgttgccaaattcttcaacagtccc
aatgcaaaggcaatgttgttcatcaacttcactgccgaaggtgctgaatctttcaaatca
aaataccgtgaagctgctgagcaacataaacaacagggtgtaagctttttggtgggagat
gttgagtctagtcaaggtgctttccagtattttggactgaaagaagaacaagtacctcta
attatcattcaacacaatgacgggaaaaagttttttaaacccaatttggaagctgatcac
attccaacttggttgaaggcgtacaaggatggtaatgttgcaccatttgtgaagtctgaa
cccattcctgaagctaacgatgaacctgttaaagtggtagttgggaacagtcttgaggac
attgttttcaaatctgggaagaatgttctgctggagttttatgctccctggtgtggtcat
tgcaaacagttggctccaatattggacgaagttgctatctcatatcaaagtgatgctgat
gttgttattgcaaaactggatgcaactgccaacgatatcccaagtgaaacctttgatgtc
caaggttatccaaccgtgtacttcaggtcagcaagtggaaagttatcacaatacgaaggg
ggtaggaccaaggaagacatcatagaattcatcgaaaagaaccgggacaaacctgctcag
caagaacaaggacaagataaacctgctcagcaagaacaaggacaagatgagcaagaaaaa
ggaaaagatgagctttga

DBGET integrated database retrieval system