KEGG   Glycine max (soybean): 100170706Help
Entry
100170706         CDS       T01710                                 

Gene name
PDIL-2
Definition
protein disulfide isomerase-like protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100170706 (PDIL-2)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100170706 (PDIL-2)
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100170706 (PDIL-2)
  Exosomal proteins of colorectal cancer cells
   100170706 (PDIL-2)
  Exosomal proteins of bladder cancer cells
   100170706 (PDIL-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 551 aa AA seqDB search
MRILVVLSLATLLLFSSLFLTLCDDLTDDEDLGFLDEPSAAPEHGHYHDDDANFGDFEED
PEAYKQPEVDEKDVVILKEKNFTDTVKSNRFVMVEFYAPWCGHCQALAPEYAAAATELKG
EDVILAKVDATEENELAQQYDVQGFPTVYFFVDGIHKPYNGQRTKDAIMTWIKKKIGPGI
YNLTTVEDAQRILTNETKVVLGFLNSLVGPESEELAAASRLEDDVNFYQTVDPDVAKLFH
IDPDVKRPALILVKKEEEKLNHFDGKFEKSEIADFVFSNKLPLVTIFTRESAPSVFENPI
KKQLLLFATSNDSEKLIPAFKEAAKSFKGKLIFVYVEMDNEDVGKPVSEYFGISGNAPKV
LGYTGNDDGKKFVLDGEVTADKIKAFGDDFLEDKLKPFYKSDPVPESNDGDVKIVVGNNF
DEIVLDESKDVLLEIYAPWCGHCQALEPIYDKLAKHLRNIESLVIAKMDGTTNEHPRAKP
DGFPTLLFFPAGNKSFDPITVDTDRTVVAFYKFLKKHASIPFKLQKPTSTSDAKGSSDAK
ESQSSDVKDEL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctcgttgtgctctctctcgccaccctcctcctcttctcctccctctttctc
accctctgcgacgacctcaccgacgacgaggacctcggcttcctcgacgagccctccgcc
gcgccggagcacggccactaccacgacgatgacgccaatttcggcgacttcgaggaggac
ccggaggcgtacaagcagcccgaggtggacgagaaggacgtcgtcattttgaaggagaag
aacttcaccgacaccgtcaagagcaaccgcttcgtaatggtcgagttctacgcgccctgg
tgcggccactgccaggccctcgcccccgaatacgccgccgccgcaacggagctcaagggc
gaagacgtaattttggcgaaagtggatgccacggaagagaatgaattggcgcagcagtat
gatgttcagggtttccctactgtctacttcttcgttgatggcattcacaagccttataat
ggccaaaggaccaaagatgctataatgacgtggattaagaaaaagatcggacctggtata
tacaacttgactacagtggaggatgctcaacgcatcttgaccaacgaaactaaagttgtt
ttgggcttcctcaactctttagttggtcctgagagtgaggagcttgctgctgcttcaaga
cttgaggatgatgtcaatttttatcaaactgtggatcctgatgtggcaaagcttttccat
attgacccagatgttaagcgcccagctttgatcctcgtcaagaaagaggaggaaaaactt
aaccactttgatggcaaatttgagaagtcggaaatagcagactttgtcttctccaacaag
cttcctttggtaacaatttttacaagagaaagtgccccatcagtcttcgaaaatccaatc
aagaaacagttgttgctgtttgcaacttcaaatgattcagagaagttgatccctgcattt
aaagaagctgcaaaatctttcaagggaaagttgatctttgtatatgtggaaatggataac
gaagatgttggaaagcctgtttcagaatactttggtatcagtgggaatgctccaaaagta
cttgggtacactgggaatgatgatggaaaaaaatttgtgcttgatggagaggtgactgct
gacaaaattaaggcatttggggacgatttccttgaagacaagctaaaacctttttacaag
tcagatccagttcctgaaagtaatgatggtgatgtgaaaatagtagttgggaataatttt
gatgaaattgtcttggatgagtcaaaggatgttctcctcgagatttatgctccctggtgt
ggccattgccaagcactggagccaatatacgacaagcttgcaaaacatcttcgtaatatt
gagtctcttgtaatagccaagatggatggaacaacaaatgagcatcccagggctaagcct
gatggatttcccactctcctcttcttcccggcaggaaacaagagttttgaccctattact
gttgatacagatcgtacagtggtagccttctacaagttcctcaagaaacatgcatcaatc
ccattcaagctccagaaaccaacctcaacttctgatgccaaggggagctctgatgccaaa
gagagccagagtagtgatgtgaaggatgaattatga

DBGET integrated database retrieval system