KEGG   Glycine max (soybean): 100305460Help
Entry
100305460         CDS       T01710                                 

Definition
protein disulfide isomerase like protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100305460
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100305460
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100305460
  Exosomal proteins of colorectal cancer cells
   100305460
  Exosomal proteins of bladder cancer cells
   100305460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 520 aa AA seqDB search
MKPTLRFIVFLLTLLLVLRFNVATEVKDELEELLAVDEEVEREAEKGGEKLSEAEVLSKA
QRIVIELKNENTERVVNGNEFVLVLGYAPWCPRSAELMPHFAEAATSLKELGSPLIMAKL
DADRYPKPASFLGVKGFPTLLLFVNGTSQPYSGGFTADDIVIWAQKKTSTPVIRISSVAE
AEKFLTKYQTFLIGRFENFEGPDYEEFVSAAKSDNEIQFVETSQVELAQVLYPDIKPTDR
FLGIVKSEPERYSAYDGAFILNKILEFVDYNKFPLVTKLTEMNSVRVYSSPIKLQVLVFA
NIDDFKNLLDTLQDVAKTFKSKIMFIYVDINDENLAKPFLTLFGLEESKNTVVGAFDNSM
SSKYLLESKPTQINIEEFCNNLMQGSLSPYFKSQPIPDNTEASVRAIVGKTFDDEILSSK
KDVLLEVFTPWCMNCEATSKQVEKLAKHYKGSSNLIFARTDASANEHPKLQVNDYPTLLF
YRADDKANPIKLSTKSSLKELAASINKYLKVKNQVLKDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccactttaagattcatcgttttcctcctcacccttctcctggtactgaggttt
aacgttgccacagaggttaaggatgagttggaggaattgttagcagtggacgaggaagta
gaacgggaagccgaaaagggtggcgagaaattatccgaagcagaggttttgagcaaagcc
caaaggatcgtaattgagctcaagaacgagaacacagagagggttgtgaatgggaacgag
tttgttcttgttctggggtatgcaccttggtgtccaaggagtgctgagctaatgccccat
tttgcagaggctgcaacttctctcaaggaattgggaagccctcttattatggccaaactt
gatgctgacaggtatcccaagccagcttctttccttggtgtcaaaggcttccccactttg
cttctctttgtcaatggcacctctcagccctactctggcggtttcacagcagatgatata
gtgatatgggcacaaaaaaagactagtactcctgtcattcggataagttcagtggcagaa
gcagaaaagtttctgacaaagtatcaaacatttcttattggtcggtttgaaaattttgag
ggacctgattatgaagaatttgtgagtgctgcaaagtctgataatgaaatccagtttgtg
gaaacgagtcaggtagagcttgctcaagttctttatccagatatcaagcctaccgatcgt
tttcttggaattgttaagagtgaacccgaaagatacagtgcttatgatggagctttcata
ctgaataaaatactggaatttgtagactacaacaagtttccattagttacaaagctgact
gaaatgaattctgtcagagtctactccagtcccatcaagcttcaggttttagtctttgca
aacattgatgacttcaagaatcttcttgatactcttcaagatgttgcaaaaacattcaag
tcaaagataatgtttatatatgtggatattaatgacgagaaccttgcaaagcccttctta
acattgtttggtcttgaggaatcaaaaaatactgtggtaggcgcgtttgataattcaatg
agctcaaaatatttgttggagtcaaaaccaacacaaatcaatattgaagagttctgcaat
aatctcatgcaaggttctttgtcgccatacttcaagtcacagccaattccagataacaca
gaagcaagtgttcgtgctattgtcgggaaaacatttgatgatgaaatcttgagcagcaag
aaggatgtgctcttggaggtatttacgccttggtgtatgaactgtgaggccacaagcaag
caagtagagaagttggcaaagcactacaaaggatcaagtaatctaatatttgcaaggaca
gatgcttcagcaaatgaacatccaaaactgcaagtgaatgactaccccacgcttctattt
tacagagcagatgataaggcaaacccgatcaaactttctacaaaatctagtttgaaagag
ttggctgcatccatcaacaaatatctaaaagtcaagaatcaagtactcaaagatgagtta
tag

DBGET integrated database retrieval system