KEGG   Glycine max (soybean): 100305685Help
Entry
100305685         CDS       T01710                                 

Definition
uncharacterized LOC100305685
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gmx  Glycine max (soybean)
Brite
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100305685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 175 aa AA seqDB search
MGTASSMLTQYDIEEVQEHCNNLFSQQEIVSLYQRFCQLDRNAKGFISADEFLSVPEFAM
NPLSQRLLKMADGLNFKDFVAFLSAFSAKASAQQKIELIFKVYDSDRNGKVSFKDMLEVL
KDLSGSFMSDDQREEVLSQVLREAGYTKDSYLTLDDFIKVLGQSDLKMDVEVPVD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggactgcatcatctatgttaactcaatacgacatcgaggaagttcaggaacactgc
aataatttattttcccagcaggaaattgtgtccttgtatcaaaggttttgtcaacttgac
cgcaatgccaagggatttatttccgcagatgagttcttgtctgttcccgaatttgccatg
aatccactttctcagaggctgctaaagatggccgacggcttgaattttaaagactttgtg
gccttcttatctgcattcagtgccaaagccagcgcacaacaaaaaattgagcttattttc
aaagtatacgattcagaccgcaatggaaaggtgtctttcaaagatatgctggaagtgcta
aaagatttgtcgggttcattcatgtctgatgaccaaagagaggaagttctcagccaggtt
ctaagggaagcgggatacacaaaggactcctacttgacattggatgacttcattaaagtt
cttggtcaatctgacctaaaaatggatgttgaagtccctgttgattga

DBGET integrated database retrieval system