KEGG   Glycine max (soybean): 100305866Help
Entry
100305866         CDS       T01710                                 

Definition
uncharacterized LOC100305866
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 148 aa AA seqDB search
MAPKAEKKPAEKKPAEEKKSTVGDKAPAEKKPKAGKKLPKEGGAGGEGKKKKRNKKSVET
YKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQT
AVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggcagagaagaagccagcagagaagaagcccgcggaggagaagaaatcg
acggtgggagacaaggctccggcggagaagaagccaaaggccggaaagaagcttccgaag
gagggaggcgccggcggagaagggaagaagaagaagagaaacaagaagagcgtggagaca
tacaagatctacatcttcaaggttctgaagcaggttcaccctgacattggtatctcaagc
aaggccatgggaatcatgaacagcttcatcaacgacatcttcgagaagcttgcccaggaa
tcttctagacttgcccgctacaacaagaaacccaccatcacttcgagggaaattcagacc
gcggtcaggcttgtgctgcccggtgaattggccaagcacgccgtttctgagggtacgaag
gctgtcaccaagttcactagctcttga

DBGET integrated database retrieval system