KEGG   Glycine max (soybean): 100305937Help
Entry
100305937         CDS       T01710                                 

Definition
(RefSeq) uncharacterized LOC100305937
  KO
K08738  cytochrome c
Organism
gmx  Glycine max (soybean)
Pathway
gmx01100  Metabolic pathways
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100305937
NCBI-ProteinID: NP_001235212
UniProt: C6SX87
Position
1
AA seq 113 aa AA seqDB search
MASFDQAPPGDVKSGDKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSSA
NKNMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTAQ
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgatcaggcacctcccggcgatgtcaaatccggtgacaaaatcttcagg
accaagtgcgctcagtgccacaccgtcgaaaaaggtgccggtcacaagcaaggacccaat
ctgaatggtttgtttggaaggcaatctggcacaactcccggatattcctactcttcagct
aacaagaacatggctgtgacttgggaagaaaagacactatacgattacttgcttaacccc
aaaaagtatattccagggacaaagatggtatttcctggtcttaagaagcctcaggaacgt
gctgatcttattgcatatctgaaagaatccactgcacagtga

DBGET integrated database retrieval system