KEGG   Glycine max (soybean): 100305937Help
Entry
100305937         CDS       T01710                                 

Definition
uncharacterized LOC100305937
Orthology
K08738  
cytochrome c
Organism
gmx  Glycine max (soybean)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100305937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 113 aa AA seqDB search
MASFDQAPPGDVKSGDKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSSA
NKNMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTAQ
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgatcaggcacctcccggcgatgtcaaatccggtgacaaaatcttcagg
accaagtgcgctcagtgccacaccgtcgaaaaaggtgccggtcacaagcaaggacccaat
ctgaatggtttgtttggaaggcaatctggcacaactcccggatattcctactcttcagct
aacaagaacatggctgtgacttgggaagaaaagacactatacgattacttgcttaacccc
aaaaagtatattccagggacaaagatggtatttcctggtcttaagaagcctcaggaacgt
gctgatcttattgcatatctgaaagaatccactgcacagtga

DBGET integrated database retrieval system