KEGG   Glycine max (soybean): 100499636Help
Entry
100499636         CDS       T01710                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100499636
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100499636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 237 aa AA seqDB search
MVVEDTQKSVITEDQYPSRVVSDNNNDDDDDDLEEGEIPVDGEDSGATATTKPPAALARN
PHPLENSWTFWFDNPSSKSKQAAWGSSIRPIYTFATVEEFWSIYNNIHHPSKLGLGADFH
CFKHKIEPKWEDPICANGGKWTMTFPRGKSDTSWLYTLLAMIGEQFDHGDEICGAVVNVR
SRQDKIAIWTKNASNEAAQVSIGKQWKEFLDYNDTIGFIFHEDAKKLDRGAKNKYVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagaagatacccaaaagtcagtcatcacggaggaccaataccctagcagggtc
gtcagcgacaacaacaacgacgacgacgacgatgatctcgaagagggtgagatccccgtc
gacggcgaagatagcggcgccaccgccacaacgaagcctccggccgccctcgcccgaaac
ccccaccctctggagaattcctggaccttctggttcgacaacccttcctccaagtccaaa
caagccgcatggggcagctccatccgacccatctacactttcgccaccgttgaagagttt
tggagcatttacaataacattcaccacccgagcaagttgggtttgggggcggactttcac
tgcttcaagcacaagattgagccaaagtgggaggaccctatctgcgccaatgggggaaag
tggactatgaccttcccaaggggaaaatctgataccagttggttgtatacgttgttggcg
atgattggagaacagtttgatcacggagatgaaatatgtggagctgttgtgaatgtcaga
agtaggcaggataaaattgctatttggactaagaacgcttcaaatgaagctgctcaggtg
agcattggaaagcagtggaaggagtttcttgattacaatgacacaattggctttatattt
catgaggatgcaaagaagctggacagaggtgctaaaaataaatacgttgtatga

DBGET integrated database retrieval system