KEGG   Glycine max (soybean): 100499734Help
Entry
100499734         CDS       T01710                                 

Definition
uncharacterized LOC100499734
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Brite
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100499734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 139 aa AA seqDB search
MAPAKAEKKPAEKKPAAEKAPAEKKPKAEKKISKEGGSEKKKKRTKKSVETYKIYIFKVL
KQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGE
LAKHAVSEGTKAVTKFTSS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctccggcaaaggcagagaagaagccggcggagaagaagccagcggcggagaaggca
ccggcggagaagaagccgaaggcggagaagaagatctcgaaggaaggagggagcgagaag
aagaagaagcgcacgaagaagagcgtggagacctacaagatctacatcttcaaggtcctc
aagcaggttcaccccgacattggtatttccagcaaggccatgggcatcatgaacagcttc
atcaacgacatcttcgagaagctcgcccaggaagcgtcgcgtttggctcgctacaacaag
aagcccaccatcacctcgagggagatccagaccgccgtgcgtctcgtgctccctggtgaa
ttggccaaacacgccgtttctgaagggaccaaggcggttaccaagtttaccagctcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system