KEGG   Glycine max (soybean): 100500592Help
Entry
100500592         CDS       T01710                                 

Definition
uncharacterized LOC100500592
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gmx  Glycine max (soybean)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100500592
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100500592
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100500592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 187 aa AA seqDB search
MAIEAWLMDESNEDPRLPHRRNPNKSVSLDQLAEFGVLYWKLNPTIYENDEELAKIREDR
GYNYMDLLDLCPEKVENYEQKLKNFYTEHIHQDEEIRYCLEGSGYFDVRDKDDRWIRILI
KAGDLIILPAGIYHRFTLDPSNYVKLMRLFKGEPVWTAYNRPQEDNPARKEYIKGLTEKS
GVPLATH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaggcatggttgatggacgaaagcaatgaagatccaagactccctcaccgc
cgcaatcccaacaagtcagtttcattggaccaattagcagaatttggggtgttatactgg
aagctgaatccaactatctatgagaacgatgaagagttggccaagattagagaagatagg
ggatacaactacatggacctgcttgatttatgcccagaaaaggtggaaaattatgaacag
aagttgaagaacttctacactgagcacattcatcaggatgaagagattcgttattgttta
gaaggaagtggctactttgatgtgcgagacaaggatgatcgctggattcgcattttgatc
aaggccggtgatcttatcattttacccgctggaatctatcatcgcttcaccctagaccca
agtaactatgtgaagttaatgaggttgtttaagggcgagccagtgtggacagcatataat
cgaccacaggaagacaatcctgctagaaaggaatacattaagggcctgactgagaaatct
ggagtgccacttgcaactcattag

  All links  
No link information was found.   
DBGET integrated database retrieval system