KEGG   Glycine max (soybean): 100526845Help
Entry
100526845         CDS       T01710                                 

Gene name
PDIL-3b
Definition
(RefSeq) protein disulfide isomerase like protein
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100526845 (PDIL-3b)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100526845 (PDIL-3b)
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100526845 (PDIL-3b)
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100526845 (PDIL-3b)
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100526845 (PDIL-3b)
  Exosomal proteins of colorectal cancer cells
   100526845 (PDIL-3b)
  Exosomal proteins of bladder cancer cells
   100526845 (PDIL-3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 523 aa AA seqDB search
MCTMKPTLRFILVLLTLLLVLRFNVASEVEDELEELLAVDEEVEQEAEKGGEKLSEAEVL
SKARRIVIELNNDNTERVVNGNEFVLVLGYAPWCPRSAELMPHFAEAATSLKELGSPLVL
AKLDADRYSKPASFLGVKGFPTLLLFVNGTSQPYSGGFAADDIVIWAQKKTSTPVIRIGS
VTEAEKFLRKYQTFLIGRFDKFEGPDYEEFVSAAQSDNEIQFVETNQVELAQVLYPDIKP
TDQFLGIVKSEPERYTAYDGAFTMNKILEFVDYNKFPLVTKLTEMNSIRVYSSPIKLQVL
VFANIDDFKNLLETLQDVAKTFKSKIMFIYVDINDENLAKPFLTLFGLEESKNTVVAAFD
NAMSSKYLLETKPTQSNIEEFCDNLVQGSLSPYFKSQPIPDNTESSVHVIVGKTFDDEIL
SSEKDVLLEVFTPWCINCEATSKQVEKLAKHYKGSSNLIFARIDASANEHPKLQVNDYPT
LLLYRADDKANPIKLSTKSSLKELAASINKYVKVKNQVVKDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacgatgaaacccactttaagattcatcttggtccttctcacccttctcttggtg
ctgaggtttaacgttgcctcagaggttgaggatgagttggaggaattgttagcagtggat
gaggaagtagagcaagaagcggaaaagggtggcgagaagttatccgaagcagaggttttg
agcaaagcccgaaggatcgtaattgagctcaacaacgacaacacagagagggttgttaat
gggaacgagttcgttcttgttctggggtatgcaccttggtgtccaaggagtgctgagctc
atgccccattttgcagaggctgcaacttctctcaaggaattgggaagccctcttgttttg
gccaaacttgatgctgacaggtattccaagccagcttctttccttggagtcaaaggcttc
cccactctgcttctctttgtcaacggcacctctcagccctactcaggtggtttcgcagca
gatgatatagtgatatgggcacaaaaaaagactagtactcctgttattcggataggttca
gtgacagaagcagaaaagtttctgagaaagtatcaaacattccttattggtcggtttgat
aaatttgagggacctgattatgaagaatttgtgagtgctgcacagtctgataatgaaatc
cagtttgttgaaacaaatcaggtagagcttgctcaagttctttatccagatatcaagcct
actgatcaatttcttggaattgtcaagagcgaacccgaaagatacactgcatatgatgga
gctttcacaatgaataaaatactggaatttgtagactacaacaagtttccattagttaca
aagctgactgaaatgaattctatcagagtctactccagccccatcaagcttcaggtttta
gtctttgcaaacattgatgacttcaagaatcttcttgaaactcttcaagatgttgcaaaa
acattcaagtcaaagataatgtttatatatgtggatattaatgatgagaaccttgcaaag
cccttcttaacattgtttggtcttgaagaatcaaaaaatactgtggtcgccgcatttgat
aatgcaatgagctcaaaatatttgttggagacaaaaccaacacaaagcaatattgaagag
ttctgcgataaccttgtgcaagggtctttgtcaccttacttcaagtcacagccaattcca
gataatacagaatcaagtgtccatgttattgtcgggaaaacatttgatgatgaaatcttg
agcagcgagaaggatgtgctcttggaggtatttacgccttggtgcatcaactgtgaggcc
actagcaagcaagtagagaagttggcaaagcactacaaaggatcaagtaatctaatattt
gcaaggatagatgcttcagcaaatgaacatccaaaactgcaagtgaatgactaccccacg
cttctactttacagagcagacgataaggcaaatccgatcaaactttccacaaaatctagt
ttgaaagagttggctgcatccattaacaaatatgtaaaagtcaagaatcaagtcgtcaaa
gatgagttatag

DBGET integrated database retrieval system