KEGG   Glycine max (soybean): 100526845Help
Entry
100526845         CDS       T01710                                 

Definition
protein disulfide isomerase like protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100526845
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100526845
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100526845
  Exosomal proteins of colorectal cancer cells
   100526845
  Exosomal proteins of bladder cancer cells
   100526845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 523 aa AA seqDB search
MCTMKPTLRFILVLLTLLLVLRFNVASEVEDELEELLAVDEEVEQEAEKGGEKLSEAEVL
SKARRIVIELNNDNTERVVNGNEFVLVLGYAPWCPRSAELMPHFAEAATSLKELGSPLVL
AKLDADRYSKPASFLGVKGFPTLLLFVNGTSQPYSGGFAADDIVIWAQKKTSTPVIRIGS
VTEAEKFLRKYQTFLIGRFDKFEGPDYEEFVSAAQSDNEIQFVETNQVELAQVLYPDIKP
TDQFLGIVKSEPERYTAYDGAFTMNKILEFVDYNKFPLVTKLTEMNSIRVYSSPIKLQVL
VFANIDDFKNLLETLQDVAKTFKSKIMFIYVDINDENLAKPFLTLFGLEESKNTVVAAFD
NAMSSKYLLETKPTQSNIEEFCDNLVQGSLSPYFKSQPIPDNTESSVHVIVGKTFDDEIL
SSEKDVLLEVFTPWCINCEATSKQVEKLAKHYKGSSNLIFARIDASANEHPKLQVNDYPT
LLLYRADDKANPIKLSTKSSLKELAASINKYVKVKNQVVKDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacgatgaaacccactttaagattcatcttggtccttctcacccttctcttggtg
ctgaggtttaacgttgcctcagaggttgaggatgagttggaggaattgttagcagtggat
gaggaagtagagcaagaagcggaaaagggtggcgagaagttatccgaagcagaggttttg
agcaaagcccgaaggatcgtaattgagctcaacaacgacaacacagagagggttgttaat
gggaacgagttcgttcttgttctggggtatgcaccttggtgtccaaggagtgctgagctc
atgccccattttgcagaggctgcaacttctctcaaggaattgggaagccctcttgttttg
gccaaacttgatgctgacaggtattccaagccagcttctttccttggagtcaaaggcttc
cccactctgcttctctttgtcaacggcacctctcagccctactcaggtggtttcgcagca
gatgatatagtgatatgggcacaaaaaaagactagtactcctgttattcggataggttca
gtgacagaagcagaaaagtttctgagaaagtatcaaacattccttattggtcggtttgat
aaatttgagggacctgattatgaagaatttgtgagtgctgcacagtctgataatgaaatc
cagtttgttgaaacaaatcaggtagagcttgctcaagttctttatccagatatcaagcct
actgatcaatttcttggaattgtcaagagcgaacccgaaagatacactgcatatgatgga
gctttcacaatgaataaaatactggaatttgtagactacaacaagtttccattagttaca
aagctgactgaaatgaattctatcagagtctactccagccccatcaagcttcaggtttta
gtctttgcaaacattgatgacttcaagaatcttcttgaaactcttcaagatgttgcaaaa
acattcaagtcaaagataatgtttatatatgtggatattaatgatgagaaccttgcaaag
cccttcttaacattgtttggtcttgaagaatcaaaaaatactgtggtcgccgcatttgat
aatgcaatgagctcaaaatatttgttggagacaaaaccaacacaaagcaatattgaagag
ttctgcgataaccttgtgcaagggtctttgtcaccttacttcaagtcacagccaattcca
gataatacagaatcaagtgtccatgttattgtcgggaaaacatttgatgatgaaatcttg
agcagcgagaaggatgtgctcttggaggtatttacgccttggtgcatcaactgtgaggcc
actagcaagcaagtagagaagttggcaaagcactacaaaggatcaagtaatctaatattt
gcaaggatagatgcttcagcaaatgaacatccaaaactgcaagtgaatgactaccccacg
cttctactttacagagcagacgataaggcaaatccgatcaaactttccacaaaatctagt
ttgaaagagttggctgcatccattaacaaatatgtaaaagtcaagaatcaagtcgtcaaa
gatgagttatag

DBGET integrated database retrieval system