KEGG   Glycine max (soybean): 100527024Help
Entry
100527024         CDS       T01710                                 

Definition
(RefSeq) uncharacterized LOC100527024
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     100527024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 229 aa AA seqDB search
MALLTSQPKNPILHRFTTLHCPLPRLHRTVLGLGSFSHNSALSTKKLNFNPTQTKISLQN
NPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILLSEVEVKRERRVFFGRKWNSLDFGT
AGIVLAMHLLCVFAPFHFNWPAFWVAVALYIVTGLFGVTLSFHRNLSHRSFKLPKWLEYF
FAYCGVLALQGNPIDWVSTHRYHHQFCDSERDPHSPTERILVQSYELAI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctcacatcccaacctaaaaaccccattctccatcgcttcaccacccttcac
tgccctcttccacgcttacatagaaccgttcttggtcttggctccttctctcacaacagt
gctctctccactaaaaaacttaactttaacccaacacaaaccaaaatttcccttcaaaac
aacccctttacctataatttggcagtgacagccaaagccaatgccaatgctgcatttgga
gaaggtttcaaggaggaaggggcatcgagacacagaaagattttgttgtcagaggttgag
gtgaagagagagaggagagttttctttggcagaaaatggaactctttggattttggcact
gctggaattgtgttggcaatgcatctcctttgcgtctttgctccattccatttcaattgg
ccagctttttgggtggctgtggctctctatattgtcactggcctttttggtgtcactctt
tctttccataggaacctttctcacaggagtttcaagcttcccaaatggcttgaatacttc
tttgcctattgtggggtcctggctcttcaggggaatccgattgattgggtgagcacacat
aggtaccatcaccagttttgtgattctgagagagaccctcatagcccaactgaaaggatt
ctggttcagtcatatgagttggctatttga

DBGET integrated database retrieval system