KEGG   Glycine max (soybean): 100527024Help
Entry
100527024         CDS       T01710                                 

Definition
uncharacterized LOC100527024
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gmx  Glycine max (soybean)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100527024
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100527024
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100527024
Lipid biosynthesis proteins [BR:gmx01004]
 Desaturase
  First
   100527024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 229 aa AA seqDB search
MALLTSQPKNPILHRFTTLHCPLPRLHRTVLGLGSFSHNSALSTKKLNFNPTQTKISLQN
NPFTYNLAVTAKANANAAFGEGFKEEGASRHRKILLSEVEVKRERRVFFGRKWNSLDFGT
AGIVLAMHLLCVFAPFHFNWPAFWVAVALYIVTGLFGVTLSFHRNLSHRSFKLPKWLEYF
FAYCGVLALQGNPIDWVSTHRYHHQFCDSERDPHSPTERILVQSYELAI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctcacatcccaacctaaaaaccccattctccatcgcttcaccacccttcac
tgccctcttccacgcttacatagaaccgttcttggtcttggctccttctctcacaacagt
gctctctccactaaaaaacttaactttaacccaacacaaaccaaaatttcccttcaaaac
aacccctttacctataatttggcagtgacagccaaagccaatgccaatgctgcatttgga
gaaggtttcaaggaggaaggggcatcgagacacagaaagattttgttgtcagaggttgag
gtgaagagagagaggagagttttctttggcagaaaatggaactctttggattttggcact
gctggaattgtgttggcaatgcatctcctttgcgtctttgctccattccatttcaattgg
ccagctttttgggtggctgtggctctctatattgtcactggcctttttggtgtcactctt
tctttccataggaacctttctcacaggagtttcaagcttcccaaatggcttgaatacttc
tttgcctattgtggggtcctggctcttcaggggaatccgattgattgggtgagcacacat
aggtaccatcaccagttttgtgattctgagagagaccctcatagcccaactgaaaggatt
ctggttcagtcatatgagttggctatttga

DBGET integrated database retrieval system