KEGG   Glycine max (soybean): 100527204Help
Entry
100527204         CDS       T01710                                 

Definition
uncharacterized LOC100527204
Orthology
K14298  
mRNA export factor
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100527204
Messenger RNA biogenesis [BR:gmx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100527204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 347 aa AA seqDB search
MSNFLSNTNPNPNKSFEVNQPPTDSVSSLSFSPKANFLVATSWDNQVRCWEVAQNGVNVA
TVPKASITHDHPVLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPMTVAMHDAPIKEVAW
IPEMNLLVTGSWDKTLKYWDTRQSNPVHTQQLPERCYAMTVRHPLMVVGTADRNLIVYNL
QNPQVEFKRIVSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHLDDSQQGKNFTFKCHRE
GNEIYSVNSLNFHPVHHTFATSGSDGAFNFWDKDSKQRLKAMLRCSLPIPCSTFNNDGSI
FAYSVCYDWSKGAENSNPATAKTYIFLHLPQESEVRGKPRIGATGRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatttcctgagcaacactaatccgaaccctaacaagtcctttgaggtgaatcag
cctcccactgattccgtgtccagtctcagcttcagtcccaaagccaacttcctcgtcgcc
acttcttgggacaatcaggttcgttgttgggaggtagcacagaatggagttaatgttgcc
actgttcccaaggcttctataacgcacgatcatccggttttgtgctctacatggaaggat
gatggcacaactgtcttctctggtggatgtgacaagcaagtgaagatgtggcctctgtta
tctggaggccaaccaatgactgttgccatgcatgacgcacccatcaaagaagttgcttgg
attcctgaaatgaaccttttagtcacagggagctgggacaagactttgaaatactgggac
acaaggcagtcaaatccagtgcacacacagcaactcccagagcgctgctatgctatgaca
gtgagacatcctctgatggttgttggcactgctgatagaaatcttattgtttacaacttg
caaaatcctcaggttgaattcaagagaattgtttcaccattaaagtatcaaacaaggtgc
cttgctgcattccctgatcaacaaggtttcttggtcggatcaatagaaggaagggttggg
gtgcatcatttggatgatagtcagcagggtaaaaacttcacttttaaatgccatagagag
ggcaatgaaatatactcagtcaactctttaaacttccatcctgtacaccacacatttgca
acttctggttctgatggtgctttcaatttttgggataaggatagtaaacagcggctcaag
gccatgttgagatgcagcctacctattccttgcagtaccttcaacaatgatggttcaata
tttgcttactcagtctgctatgactggagtaaaggggcagaaaattctaatcctgcaaca
gcaaagacctacattttcctgcacttgcctcaggaatctgaggtcaggggcaaaccacgc
attggtgctactgggagaaagtag

DBGET integrated database retrieval system