KEGG   Glycine max (soybean): 100527297Help
Entry
100527297         CDS       T01710                                 

Definition
uncharacterized LOC100527297
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gmx  Glycine max (soybean)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gmx00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gmx00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 199 aa AA seqDB search
MKWLTFWNCISILVLSFAFFFFYCHTYTSTPSLMAEQSSKSIYDFTVKDISGNDVSLNNY
SGKVLLIVNVASQCGLTQTNYKELNVLYEKYKNQGFEILAFPCNQFAGQEPGNNEEIREV
VCTRFKAEFPIFDKVEVNGKNAAPLYKFLKEQKGGIFGDGIKWNFTKFLVNKEGKVVDRY
APTTSPLKIEKDIEKLLQS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgactttctggaactgcatatctatcctcgtgttgtcttttgctttcttc
ttcttctattgtcacacatacacatctactccttccctcatggctgagcaatcttccaag
tccatttacgatttcacagtcaaggacatcagtggaaatgatgtgagtctgaataattac
agcgggaaggttctactgattgtgaatgtcgcctcacaatgtggtttgacgcagacaaat
tacaaagaattgaatgtattgtacgagaagtacaagaatcaaggatttgaaatcttggca
tttccatgcaaccagtttgctggacaggaaccaggaaacaatgaagaaattcgggaagtt
gtttgcacaaggttcaaggctgaatttcctatctttgataaggttgaagtcaatgggaag
aatgcagcgccactttataagtttttaaaggagcagaaagggggaatatttggtgatggt
atcaagtggaacttcacaaagttcttagtaaacaaagaagggaaggttgtggacagatat
gcacctaccacctcacctctgaaaatcgagaaagacatagagaagcttttgcaatcttga

DBGET integrated database retrieval system