KEGG   Glycine max (soybean): 100527380Help
Entry
100527380         CDS       T01710                                 

Definition
(RefSeq) uncharacterized LOC100527380
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gmx  Glycine max (soybean)
Brite
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100527380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_4 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 100527380
NCBI-ProteinID: NP_001235264
UniProt: C6T458
Position
5
AA seq 213 aa AA seqDB search
MGCFHSKSARQFPAQENTANLAAETAFTVSEVEALFELFRSISSSVVDDGLISKEEFQLA
IFKNKKKDNLFANRIFDLFDVKKKGVIDFEDFVRSLNVFHPNASLEDKIAFSFRLYDLHN
TGFIERPEVKQMLIALLFESDMKLADDVIETILDKTFVEADLNQDGKIDTEEWETFVKKN
PSLLKIMTLPYLRDITTSFPSFIFNSNVDEITA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtttccactctaagtcagcgaggcagtttcctgcacaggagaatactgctaat
cttgcggcagagacagcttttactgtcagtgaggttgaagcactgtttgagctttttagg
agcatcagcagttctgttgtcgatgacggactgataagcaaggaagaattccaattggca
atcttcaaaaacaagaaaaaggataacctttttgcaaaccggatctttgatttatttgat
gtcaagaagaagggagtcattgacttcgaagactttgttagatctctgaatgttttccac
ccaaatgcatcattagaagacaagatagctttttcatttaggctctatgatttgcacaat
actggctttatagagcgccctgaggtcaagcaaatgttaattgcacttctttttgagtcg
gatatgaagttggcagatgatgtcatagaaacaattcttgacaagactttcgtggaagct
gacctaaaccaagatgggaaaatcgacaccgaagagtgggaaacttttgttaaaaagaat
ccgtcactattaaaaatcatgacccttccttatctgagggacataacaacatctttccca
agttttatatttaactctaatgtggatgagattactgcttaa

DBGET integrated database retrieval system