KEGG   Glycine max (soybean): 100527380Help
Entry
100527380         CDS       T01710                                 

Definition
uncharacterized LOC100527380
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gmx  Glycine max (soybean)
Brite
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100527380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 213 aa AA seqDB search
MGCFHSKSARQFPAQENTANLAAETAFTVSEVEALFELFRSISSSVVDDGLISKEEFQLA
IFKNKKKDNLFANRIFDLFDVKKKGVIDFEDFVRSLNVFHPNASLEDKIAFSFRLYDLHN
TGFIERPEVKQMLIALLFESDMKLADDVIETILDKTFVEADLNQDGKIDTEEWETFVKKN
PSLLKIMTLPYLRDITTSFPSFIFNSNVDEITA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtttccactctaagtcagcgaggcagtttcctgcacaggagaatactgctaat
cttgcggcagagacagcttttactgtcagtgaggttgaagcactgtttgagctttttagg
agcatcagcagttctgttgtcgatgacggactgataagcaaggaagaattccaattggca
atcttcaaaaacaagaaaaaggataacctttttgcaaaccggatctttgatttatttgat
gtcaagaagaagggagtcattgacttcgaagactttgttagatctctgaatgttttccac
ccaaatgcatcattagaagacaagatagctttttcatttaggctctatgatttgcacaat
actggctttatagagcgccctgaggtcaagcaaatgttaattgcacttctttttgagtcg
gatatgaagttggcagatgatgtcatagaaacaattcttgacaagactttcgtggaagct
gacctaaaccaagatgggaaaatcgacaccgaagagtgggaaacttttgttaaaaagaat
ccgtcactattaaaaatcatgacccttccttatctgagggacataacaacatctttccca
agttttatatttaactctaatgtggatgagattactgcttaa

DBGET integrated database retrieval system