KEGG   Glycine max (soybean): 100775264Help
Entry
100775264         CDS       T01710                                 

Definition
chalcone synthase-like
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:gmx00941]
Organismal Systems; Environmental adaptation; Circadian rhythm - plant [PATH:gmx04712]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 391 aa AA seqDB search
MVTVEEIRNAQRSHGPATILAFGTATPSNCVSQADYPDYYFRITNSEHMTDLKEKFKRMC
EKSMIKKRYMHLTEEFLKENPNMCEYMAPSLDVRQDVVVMEVPKLGKQAATKAIKEWGQP
KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPDPAVERPIFEMI
SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFEPIGISDWNSIFW
IAHPGGPAILDQVEEKLRLKPEKLQSTRHVLSEYGNMSSACVLFILDEMRKKSKEEGKST
TGEGLEWGVLFGFGPGLTVETVVLHSVPLEG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgtggaggaaatccgcaacgctcagcgttcccatggacccgccaccatcttg
gccttcggcaccgccacgccgtccaactgcgtctcccaagccgattaccctgactactac
ttccgcattaccaacagcgaacacatgactgatctcaaagaaaagttcaagcgcatgtgt
gaaaagtccatgataaagaagcgatacatgcacctgacggaggagtttctgaaagagaac
ccgaacatgtgcgagtacatggcgccatcgctggacgtgagacaagacgtagtggtgatg
gaggtgccgaagctgggaaaacaagccgcaacgaaagcgattaaggagtggggtcaacca
aagtcaaagatcacacaccttgtgttctgcaccacttcaggcgtggacatgcccggagca
gattaccagctcacgaagcttctcggcctgaggccctccgtgaagcgcctcatgatgtat
cagcagggctgcttcgccggcggcaccgtactccgcctcgcgaaggacctcgccgagaac
aacaagggtgcgagggtgctcgttgtctgctccgagataaccgccgtgacgttccgcggc
ccctcggacacgcacctcgactcgctcgtgggacaggcactgttcggagatggcgccgca
gcgttgatcatcggatcagaccccgacccagcagtggagcggccgatattcgagatgata
tcggccgcccagacaatcctgcccgactctgacggtgctatagatgggcaccttcgggag
gtgggactcacgttccacctcttgaaagatgtgcccgggatcatctcgaagaacattgag
aagagtcttgttgaagcttttgagcccatcgggatcagcgactggaactctatcttctgg
atcgcacatcccggtggtcccgcgatcctcgatcaagtcgaggagaagctccggctcaag
ccggagaaactccagtccacccggcatgtgctgagtgagtacggaaacatgtcaagcgcg
tgtgttttgttcattctggatgaaatgaggaagaagtctaaggaggaagggaagagtacc
actggagaagggttagagtggggggtgctattcggattcgggccgggtctaaccgttgag
accgttgttcttcacagtgttcccttggagggataa

DBGET integrated database retrieval system