KEGG   Glycine max (soybean): 100775264Help
Entry
100775264         CDS       T01710                                 

Definition
(RefSeq) chalcone synthase J-like
  KO
K00660  chalcone synthase [EC:2.3.1.74]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00941  Flavonoid biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx04712  Circadian rhythm - plant
Module
gmx_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100775264
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100775264
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100775264
Polyketide biosynthesis proteins [BR:gmx01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    100775264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA
Motif
Other DBs
NCBI-GeneID: 100775264
NCBI-ProteinID: XP_003553986
UniProt: I1N828
Position
19
AA seq 391 aa AA seqDB search
MVTVEEIRNAQRSHGPATILAFGTATPSNCVSQADYPDYYFRITNSEHMTDLKEKFKRMC
EKSMIKKRYMHLTEEFLKENPNMCEYMAPSLDVRQDVVVMEVPKLGKQAATKAIKEWGQP
KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPDPAVERPIFEMI
SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFEPIGISDWNSIFW
IAHPGGPAILDQVEEKLRLKPEKLQSTRHVLSEYGNMSSACVLFILDEMRKKSKEEGKST
TGEGLEWGVLFGFGPGLTVETVVLHSVPLEG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgtggaggaaatccgcaacgctcagcgttcccatggacccgccaccatcttg
gccttcggcaccgccacgccgtccaactgcgtctcccaagccgattaccctgactactac
ttccgcattaccaacagcgaacacatgactgatctcaaagaaaagttcaagcgcatgtgt
gaaaagtccatgataaagaagcgatacatgcacctgacggaggagtttctgaaagagaac
ccgaacatgtgcgagtacatggcgccatcgctggacgtgagacaagacgtagtggtgatg
gaggtgccgaagctgggaaaacaagccgcaacgaaagcgattaaggagtggggtcaacca
aagtcaaagatcacacaccttgtgttctgcaccacttcaggcgtggacatgcccggagca
gattaccagctcacgaagcttctcggcctgaggccctccgtgaagcgcctcatgatgtat
cagcagggctgcttcgccggcggcaccgtactccgcctcgcgaaggacctcgccgagaac
aacaagggtgcgagggtgctcgttgtctgctccgagataaccgccgtgacgttccgcggc
ccctcggacacgcacctcgactcgctcgtgggacaggcactgttcggagatggcgccgca
gcgttgatcatcggatcagaccccgacccagcagtggagcggccgatattcgagatgata
tcggccgcccagacaatcctgcccgactctgacggtgctatagatgggcaccttcgggag
gtgggactcacgttccacctcttgaaagatgtgcccgggatcatctcgaagaacattgag
aagagtcttgttgaagcttttgagcccatcgggatcagcgactggaactctatcttctgg
atcgcacatcccggtggtcccgcgatcctcgatcaagtcgaggagaagctccggctcaag
ccggagaaactccagtccacccggcatgtgctgagtgagtacggaaacatgtcaagcgcg
tgtgttttgttcattctggatgaaatgaggaagaagtctaaggaggaagggaagagtacc
actggagaagggttagagtggggggtgctattcggattcgggccgggtctaaccgttgag
accgttgttcttcacagtgttcccttggagggataa

DBGET integrated database retrieval system