KEGG   Glycine max (soybean): 100775404Help
Entry
100775404         CDS       T01710                                 

Definition
pectinesterase PPME1-like
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 369 aa AA seqDB search
MASKTICTTIQVTLIVAFLTTQVVFSDDTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPA
LVAAEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPF
ITLYGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQA
VALRISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRT
LGDTGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVV
KKEGWSNNNHPEHDKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSKW
LLPPPTPKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaaaactatatgcactaccattcaggtgactctcatagtagcttttctaaca
acccaggttgttttctctgatgacactgtgccaattcctgctcacaaggcacaattgggc
acatggtttagtactaatgtagggcctttagatcaaagaaaaagcactatggaccctgca
ttggtggcagctgaagaaggtgctaaggttgtgaaggtaatgcaagatggaagtggggaa
ttcaagaccatcactgatgccattaacagcatacctagtgggaacactaaacgtgtaatt
gtgtacattggagctggaaattataatgagaaaataaaaattgagaagacaaagcctttc
atcaccttgtatggcgtaccagagaaaatgccaaacttgacattcgggggaactgcacta
aaatatggcactgttgatagtgctacattgattgttgaatcagattactttgtggcagct
aacatcataatctcgaactctgcaccaagacctgatggaaaaatacaaggaggtcaagca
gtggcattgcgaatttctggtgacaaagcagcattttataattgcaagttctttggattc
caggacacaatttgcgatgataggaatagacattttttcaaagactgcttaattcaaggc
accatggattatatttttggaagtgggaagtcactatatctgagtactgaactaagaacg
cttggcgacactgggattactgttatagtggcgcaagcaagaaaaagtcctacagaggac
aatgcctactcatttgtacattgtgacgttactggaactgggaatggcactttcttgggc
agagcatggatgcctcatcctagagtggtctttgcatacagcaccatgagtgccgttgtg
aaaaaagaagggtggagtaacaacaatcatcctgaacatgacaaaaatgttcgttttgga
gagtatcagaatacgggacctggtgcagaccccaaaggacgtgctgctataactacgcaa
ctaaatgaaatgcaggtcaaaccttacataacacttgggatgattgaaggctccaaatgg
ctacttcctcctccaactcccaaagtctaa

DBGET integrated database retrieval system