KEGG   Glycine max (soybean): 100775404Help
Entry
100775404         CDS       T01710                                 

Definition
(RefSeq) putative pectinesterase 63
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00040  Pentose and glucuronate interconversions
gmx01100  Metabolic pathways
Module
gmx_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100775404
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100775404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 100775404
NCBI-ProteinID: XP_003518804
UniProt: I1JEL9
Position
2
AA seq 369 aa AA seqDB search
MASKTICTTIQVTLIVAFLTTQVVFSDDTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPA
LVAAEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPF
ITLYGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQA
VALRISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRT
LGDTGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVV
KKEGWSNNNHPEHDKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSKW
LLPPPTPKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaaaactatatgcactaccattcaggtgactctcatagtagcttttctaaca
acccaggttgttttctctgatgacactgtgccaattcctgctcacaaggcacaattgggc
acatggtttagtactaatgtagggcctttagatcaaagaaaaagcactatggaccctgca
ttggtggcagctgaagaaggtgctaaggttgtgaaggtaatgcaagatggaagtggggaa
ttcaagaccatcactgatgccattaacagcatacctagtgggaacactaaacgtgtaatt
gtgtacattggagctggaaattataatgagaaaataaaaattgagaagacaaagcctttc
atcaccttgtatggcgtaccagagaaaatgccaaacttgacattcgggggaactgcacta
aaatatggcactgttgatagtgctacattgattgttgaatcagattactttgtggcagct
aacatcataatctcgaactctgcaccaagacctgatggaaaaatacaaggaggtcaagca
gtggcattgcgaatttctggtgacaaagcagcattttataattgcaagttctttggattc
caggacacaatttgcgatgataggaatagacattttttcaaagactgcttaattcaaggc
accatggattatatttttggaagtgggaagtcactatatctgagtactgaactaagaacg
cttggcgacactgggattactgttatagtggcgcaagcaagaaaaagtcctacagaggac
aatgcctactcatttgtacattgtgacgttactggaactgggaatggcactttcttgggc
agagcatggatgcctcatcctagagtggtctttgcatacagcaccatgagtgccgttgtg
aaaaaagaagggtggagtaacaacaatcatcctgaacatgacaaaaatgttcgttttgga
gagtatcagaatacgggacctggtgcagaccccaaaggacgtgctgctataactacgcaa
ctaaatgaaatgcaggtcaaaccttacataacacttgggatgattgaaggctccaaatgg
ctacttcctcctccaactcccaaagtctaa

DBGET integrated database retrieval system