KEGG   Glycine max (soybean): 100776156Help
Entry
100776156         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 980 aa AA seqDB search
MGKKVRKKTRGSAKEKGVATHLPIKVIESSNPTVESVDEVAKETNSCPHLVKGVNFDRLS
TKIGSSGSVRCEDCREGANDRRSGKGKGKHEKKKGGASLDSKSESKSIWVCLECGRYTCG
GVGLPITPHCHVVGHARKNRHPLVVHFDKPQLCWCFPCNMLVQVDKFEKTDESCHLLSDV
VKLLKGRSQEKSSVDIEDVSVGDDSITSEIKSRALFANDSYGQAGYVVRGMINLGNTCFF
NSIMQNLLAMNRLRDDFLKLDAPVGPLISSLKKLFTETNPESGLKNVINPRSFFGCVCSK
SPQFRGYQQHDSHELLRCLLDGLSTEELAGRKQSGSPKGDGTSSNTLVDALFGGQISSTV
CCIECGHFSTVYEPFLDLSVPVPTKKPPPCKAQQVPRTKKAKLPPKKGGKTRVRVNRDTY
PLPVQTQSNQLSSSESSCPDQSVISVAGEMGTCSADSTLLGSEEIKSVADKEDLSSPNLV
TPGESQHMQVLDNGAIKTSDGFSWLDYVEAGTNECDFISQKEDAPEVQGTESKDECLNEL
HGQAICESSGLVCFLKEDENLSPKFSSANGWEDKVPLQVQGSEVLLLPYKEESSSAAEII
GGDGEASSSVLGGGQEEVEFDGFGDLFNEPEVVAGPAPRPSSCREVMEAGFIISNSESDP
DEVDDTDSPVSVESCLAHFIKPELLLDENAWHCENCSKFLQHQKMEEKKHARAVSDGNET
GIYDEPWHAVNSCSVKVRTNGNGDIKNDTNVENLVACDKHNTKLENGQRDELSLIVNERD
SGSSEMEDTHIDELQSSSFRNTCNEESCSHLAADSCVIENVQRRDSPMIGNDNNDSEEEA
GSKSVKVKRDATKRVLIYKAPPVLTIHLKRFSQDARGRLSKLNGHVNFRETMDIRPYIDP
RCINEEKYEYHLVGLVEHSGTMRGGHYVAYVRGGQRNSGKGGDKENEGSTWYQASDAYVR
EVSLDEVLRCEAYILFYEKI
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaagtcagaaagaagactcgaggttctgccaaggagaagggggttgctacc
catttgcctatcaaggttattgagtcatccaacccgactgttgagtctgttgatgaggtt
gcaaaagagactaattcttgccctcatcttgtaaaaggtgttaattttgacagattgtcc
actaagattggttcttctggatccgttaggtgtgaagattgtagggaaggtgcgaatgat
agaaggagtggtaaaggaaaaggtaaacatgagaagaagaaaggtggcgcatcattagat
tcaaaatctgagtcaaaatctatatgggtttgtttggagtgtggtcgatatacctgtgga
ggcgtggggctaccaataacccctcactgccatgtggtagggcatgcgaggaaaaatcgg
caccctttggtagttcattttgataagccccaattgtgttggtgttttccttgcaacatg
cttgttcaagttgataaatttgaaaaaactgatgaatcgtgtcatcttctatctgatgtt
gtgaaattgttgaaaggacgatcacaagaaaaatcttcagtggatattgaggatgtctcc
gttggggatgacagtattacttcagaaattaagtcaagagctctgtttgcaaatgattca
tatggacaagctggttatgtagttagaggtatgattaatcttgggaatacttgcttcttc
aattcaattatgcaaaatctgctagctatgaatagattgcgggacgactttctaaagtta
gatgctcctgttgggccacttattagttccttgaagaagcttttcactgaaacaaacccc
gaatcaggattgaaaaatgttataaatcctagatctttttttggctgtgtatgttctaag
tctccccaatttcgaggatatcagcagcatgacagtcacgaattgctccgttgtttactg
gatgggttaagtactgaagaactagctggaaggaaacagagtggttctcccaagggagat
gggacctcttccaatactttagttgatgctttattcgggggtcagatatctagtactgta
tgttgcatagagtgtgggcatttctcaacagtgtatgaacctttcttagatctttcagtg
ccagttcctactaagaaacctccaccttgcaaggcccaacaagtaccacggaccaaaaaa
gctaaacttccaccaaaaaaaggtggaaaaactcgagtcagagttaacagggacacttat
cccttaccggttcaaactcaatcaaaccaattatccagctcagaatcatcttgccctgat
cagtctgttatatcagttgctggagagatggggacttgttctgctgattctacattatta
ggttctgaagaaataaaaagtgtagctgataaagaggacttgtcttcacctaatttggtt
actcctggagagtctcaacatatgcaagtgcttgacaatggtgcaatcaaaacatcagac
ggattttcatggttggattatgtggaagctggaactaatgaatgtgatttcatttcccaa
aaggaggatgccccagaggtacagggtactgagagcaaagatgaatgtttaaatgaattg
catggacaggccatctgtgaatctagtggtcttgtttgtttccttaaggaggatgaaaac
ctaagtcccaaattttcttcagcaaatgggtgggaagacaaggttccattacaagttcaa
ggttcagaagtgctgttacttccatacaaagaagaaagttcctctgctgctgagatcatt
ggaggggatggtgaggcctcctcatctgttttgggtggtggtcaagaagaagtggagttt
gatggctttggtgacttattcaatgagcctgaagttgttgctgggcctgctcctagacca
tcttcatgtagagaggttatggaagctggttttatcataagcaacagtgagtctgatcca
gatgaagtagatgatacagattctcctgtctctgtagagagttgcttggcacattttata
aaacccgagcttctcttggatgaaaatgcttggcattgtgagaactgttcaaaatttctc
caacatcaaaagatggaagagaaaaagcatgcaagagctgtatctgatggaaatgaaact
ggaatttatgatgaaccatggcatgcagttaactcttgttctgttaaagtcagaaccaat
ggaaatggggacataaagaatgacacaaacgtagaaaatttggttgcatgtgataaacac
aacacaaagcttgaaaatggtcaaagagatgagcttagtttaattgttaatgaaagggat
agcggatcatctgaaatggaagacacacatattgatgaattacagtcttcaagttttcgt
aatacttgcaatgaagaaagctgtagtcatttagctgctgattcttgtgttattgaaaat
gtccaaagaagagattctccgatgataggtaatgataacaatgactcagaagaagaggct
ggctccaaaagcgtgaaagtgaagagggatgcaactaagagggtcctcatttataaagct
cctcctgtcttgaccattcatttgaagagattcagccaagatgcccgtggtcgcttaagt
aaattaaatggccatgtcaatttcagagaaacgatggatattagaccctatattgatccc
aggtgcataaatgaagagaagtatgaataccacttggttggcttagtggagcactccgga
actatgagagggggtcactatgttgcgtatgtgagagggggccagaggaacagtgggaag
ggtggtgataaagagaatgagggttccacatggtatcaggcaagtgatgcatatgtgcgt
gaagtttcccttgatgaagttcttcgctgtgaggcatacattttattctacgaaaaaatt
tga

DBGET integrated database retrieval system