KEGG   Glycine max (soybean): 100776553Help
Entry
100776553         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 874 aa AA seqDB search
MDCASEDCSDNSQRPDSHKDQRVYFVPHRWWKDAQDSMPEADSDKKKGIAFASFPGSSYA
GPMKIINNIFNSDLVFSLRREEDSPRIRENGEVGVSGRDFALVSGDMWLQALKWHSDSKN
VMKDDKGFSATDSDMADVYPLQLRLSVQRETNSFGVRISKKDNAVELFKRACKMFSVDSE
MLCIWDYSDQITFLMNDNNQVPVDCQRQSDQEILLELQVYGLSDSIRCREGKKDEMANFS
GSASLKMNGTYDGANSDCMNANSLTFSSGPGEAGSLGLTGLQNLGNTCFMNSSLQCLAHT
PKLVDYFLEDYIREINHDNPLGMNGEIALAFGDLLRKLWAPGASPVSPRIFKSKLARFAP
QFSGFNQHDSQELLAFLLDGLHEDLNRVKCKPYIEVKDGDGRRDEEVADEYWHNHLARND
SVIVDVCQGQYKSTLVCPVCRKVSVTFDPFMYLSLPLPSTTVRTMTITVVSGNGGEMSQL
SPYTITVPKNGRFEDLTRALGIACSLGADETLLVAEVYNNCIIRFLEDPTDSLSLIRDAD
KLVAYRFLKCNVDAPLVVFINQRMEEQYVYGKQTLNWKAFGIPVVDRLYSVTNGSDLRNL
YLKWFYPFQNPIEEALENCLVSKETEEDAETEVTTPSLGSNVNELDTPSDGGMEFYVTDE
KGTIKNSKILMNEPLAINGDLRLLHVLVCWSEEQLKIYDTQLCSSLPEVFKSGFLAKRPQ
ESVSLYKCLEAFLQEEPLGPEDMWYCPGCKEHRQASKKLDLWRLPEILVIHLKRFQYSRY
LKNKLETYVDFPVDNLDLSAYITYGNDESYHYTLYAVSNHYGSMGGGHYTAFVHRGGDQW
YDFDDSHVNPISKEKIKSSAAYVLFYRRNFEVST
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgcctccgaagattgctccgataactctcagcgaccggactcacacaaggac
cagcgagtctatttcgttcctcacaggtggtggaaggatgctcaggattcaatgccggag
gcagattcggataagaagaagggaattgcgtttgcctcttttccaggttcgtcctatgct
ggtcctatgaagattatcaataacattttcaactcagatcttgtgttcagtcttcggagg
gaggaggattcaccacgcattcgtgaaaatggcgaggttggtgtgtctggccgggacttt
gctttggtgtctggggatatgtggttgcaggcactcaagtggcatagtgattcaaaaaat
gtaatgaaggatgacaaaggcttttcagctactgacagtgatatggcagatgtatatcct
ttacaactcaggctttctgttcagagggaaacaaattcatttggagtaagaataagcaaa
aaggacaatgcagttgagctctttaaaagagcctgcaaaatgttcagtgtggattcagag
atgttatgcatttgggactattcagatcagataacatttttaatgaatgacaacaatcag
gtcccagttgactgtcaaaggcagtctgatcaggagattcttttggagttgcaagtttat
gggttgtcagactcaattagatgtagggaaggtaaaaaagacgagatggcaaatttttct
ggcagtgcttcactgaagatgaatggcacttatgatggtgcaaattctgattgtatgaat
gccaattctttgaccttctcttcaggccctggtgaagctggttccttgggattaactggg
ttacaaaacctaggaaacacttgcttcatgaacagttccctacagtgtttagcacataca
ccaaagcttgttgattattttctggaagattatattagagaaatcaatcatgataaccca
ttgggcatgaatggtgagatagctttggcatttggagatctgctcaggaagttatgggcc
cctggagcaagtcctgtgtcaccaagaatattcaaatcaaaacttgctagatttgcacct
cagttcagtggatttaatcagcatgattcccaagaacttcttgcttttttgttggatggt
cttcatgaagatctgaatcgtgttaaatgtaagccttatattgaagtcaaggatggagat
ggtcgacgagatgaagaggttgctgatgaatattggcataatcatttggctcgcaatgat
tctgtcattgttgatgtgtgccaaggtcaatataaatcaacattagtttgtcctgtttgt
aggaaggtctctgtgacatttgatccattcatgtacttatcattacctctaccttcaaca
acagtgcggacaatgactataactgttgttagtggcaatggtggtgaaatgtctcaatta
tcaccatacactattactgttccaaaaaatggaagatttgaagatctgacccgtgctctt
ggcattgcatgctctttgggggctgatgagaccttattagtagctgaggtatacaacaat
tgcatcatacgttttcttgaagatccaactgattcattatccttaatcagagatgctgac
aaactagttgcttaccgatttttgaaatgtaatgtggatgcccctttggttgtcttcata
aaccagcggatggaggagcagtatgtctatgggaagcagactctgaattggaaagccttt
ggaattcctgttgtagataggctttatagtgttacaaatggatctgatctccgcaatttg
tatctaaagtggttctatccatttcaaaatccaattgaagaggccttagaaaattgtctc
gtgtctaaggaaactgaagaagatgcagaaacggaggtcacaactcctagtttaggttca
aatgtgaatgagttagacactccttcagatggaggaatggagttttatgttactgatgaa
aagggaactataaaaaattccaagatattaatgaatgagcctctagcaataaatggagac
ttaaggctgctgcacgtgcttgtgtgttggtcagaagaacagcttaagatatatgacacg
caactttgtagttcattgcctgaggttttcaagtctggctttttagcaaagagacctcaa
gaatcagtttctctatacaagtgccttgaagcatttttgcaagaagaacctcttggacca
gaagacatgtggtactgtcctggctgtaaagaacatcgtcaagctagtaagaagttagat
ctttggagacttcctgaaattttggtcattcatcttaagaggtttcaatacagtcgttac
ttgaaaaacaagctggagacatatgttgacttccctgtagataatctcgatttgtcagct
tatattacctatgggaatgatgagtcttaccattacacactttatgctgtcagtaaccat
tatggaagcatgggaggtggtcattataccgcatttgtccatcgaggcggtgatcagtgg
tatgacttcgatgatagccatgttaatcccatcagcaaggagaagataaagtcttcagct
gcctatgttcttttctacagaagaaatttcgaagtatcaacatag

DBGET integrated database retrieval system