KEGG   Glycine max (soybean): 100776871Help
Entry
100776871         CDS       T01710                                 

Definition
beta-hexosaminidase 1-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gmx  Glycine max (soybean)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100776871
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100776871
   00603 Glycosphingolipid biosynthesis - globo series
    100776871
   00604 Glycosphingolipid biosynthesis - ganglio series
    100776871
   00511 Other glycan degradation
    100776871
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100776871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 565 aa AA seqDB search
MFVFKPTSSLLFLLLSISYSASSVTSLTVPPRGGAPLDLTTTPQQQTDGDDDSLTYLWPL
PAEFTSGGDTLSVDPALTLSVAGNGGGSAILREAFGRYRGIVFKNTAGVGFSFIRKLRER
LVSSVSAFDVDTLKITVHSDNEELQFGVDESYTLLVPKAKESSQVTIEANTVYGALRGLE
TFSQLCSFDYTTKTVKIYKAPWSIQDKPRFAYRGLMLDTSRHYLPIDVIKQIIESMSYAK
LNVLHWHIIDEQSFPLEIPTYPNLWKGSYTKWERYTVEDAYEIVNFAKMRGINVMAEVDV
PGHAESWGAGYPDLWPSPYCREPLDVSKNFTFDVISGILADMRKLFPFELFHLGGDEVNT
DCWSSTSHVKEWLQSHNMTTRDAYQYFVLKAQEMAVSKNWSPVNWEETFNTFPSKLHPKT
IVHNWLGPGVCPKVVAKGFRCIYSNQGVWYLDHLDVPWDEVYTAEPLQGIHTASEQELVI
GGEVCMWGETADTSNVQQTIWPRAAAAAERLWSQRDSTSQNITLIALPRLQNFRCLLNRR
GVPAAPVTNYYARRAPVGPGSCYEQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtcttcaaacccacctcttctcttctctttctcctcctcagtatttcatactct
gcttcttcagttacctcactcaccgtaccgccgcgagggggggccccactcgacctcacc
actactccgcaacaacaaaccgatggcgatgatgattccctcacctacctctggcccctc
cccgcagagttcacttccggcggcgacactctctccgttgaccccgcgctcaccctctcc
gtcgccggaaacggcggtggctccgccattctcagagaggccttcggccgatacagaggg
atcgtgttcaagaacaccgctggtgtcgggtttagtttcatcagaaagctgagggaacga
ttggtgtcttctgtttcggcattcgacgttgacactttgaagatcacagtccattcagac
aacgaggagcttcaatttggagtggatgaaagctataccttgctggttcccaaagccaag
gaatcttcccaagtcacgattgaggcaaatacagtttatggtgcattgcgcggattagag
acattcagccagttgtgttctttcgattatacaactaaaacagtaaaaatatacaaggca
ccttggtccatccaagataaacctagatttgcatatcgtgggcttatgctggatacatca
aggcactatttacctattgatgtaattaagcagattattgaatctatgtcctatgctaaa
cttaatgttctacattggcacatcatagatgagcagtcatttcctcttgagatacccaca
tatccaaacttgtggaaaggttcatatacaaaatgggaacgttacacagtagaagatgca
tatgaaattgtcaacttcgccaaaatgagaggcataaatgtgatggcagaagtggatgtc
cctggtcatgcagaatcatggggtgctggatatcctgatctttggccatcaccttactgt
agggagccacttgatgtttcaaagaactttacttttgatgtcatttctggtattttggca
gatatgagaaagcttttcccatttgagctatttcacttgggtggtgatgaagttaataca
gattgctggagtagtacttctcatgtaaaggaatggcttcagagtcacaacatgaccact
agagatgcttatcaatattttgtactgaaggcccaagagatggctgtttcgaaaaattgg
agtccagtgaactgggaggaaaccttcaatacgtttccatcaaagctccatccaaaaacc
atagtgcacaactggttgggccctggtgtttgtccaaaggttgtcgcaaaaggtttcagg
tgcatttacagtaaccagggtgtctggtatcttgaccatctggatgtaccttgggatgag
gtatatacagctgagccactacagggaatacatacagcttccgaacaagagcttgtaatt
ggaggagaagtttgcatgtggggtgagacggctgatacatccaatgttcagcaaacaata
tggcctcgagctgctgcagctgcagaacgcttatggagtcagagagattctacctcacaa
aatattaccttaatagcattgccccggttgcaaaacttcagatgtctattgaatagacga
ggggttccagctgctcctgtcacaaattattatgctagaagggcacctgttggtccaggg
tcatgttatgaacaataa

DBGET integrated database retrieval system