KEGG   Glycine max (soybean): 100777178Help
Entry
100777178         CDS       T01710                                 

Definition
regulatory-associated protein of TOR 1-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 1373 aa AA seqDB search
MALGDLMASRFSQSTVLVVPTSHNHLDDSTTASSSSSAAAAVAALNNNSSSNDDADFAHR
RDSEAAIAIISSGNYAGNAATSMAYLPHTVVLCELRHDAFEAAVPAGPSDSGLVSKWRPK
DRMKTGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMAPQKALESIGKTLSSQYER
WQPKARYKCQLDPTVDEVKKLCTTCRKYAKSERVLFHYNGHGVPKPTANGEIWVFNKSYT
QYIPLPINELDSWLKTPSIYVFDCSAAGMIVNSFIELHEWSASNSSVSQRDCILLAACEA
HETLPQSAEFPADVFTSCLTTPIKMALRWFCTRSLLRESLDYSLIDKIPGRPNDRKTLLG
ELNWIFTAVTDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPVSHPML
PPTHQHHMWDAWDMAAELCLSQLPSLVEDPNAEFQPSTFFTEQLTAFEVWLDHGSEHKKP
PEQLPIVLQVLLSQCHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTTTPELRQ
ILVFIWTKILALDKSCQVDLVKDGGHIYFIKFLDSMEAYPEQRAMAAFVLAVIVDGHRRG
QEACIEAGLIHVCLKHLQSSCPNDSQTEPLFLQWLCLCLGKLWEDFSEAQTIGLQEDATT
IFAPLLSEPQPEVRASAVFALGTLLDVGFDSCRSVGGDEECDDDDKFRAEVSIVKSMLDV
ASDGSPLVRAEVAVALARFAFGHNKHLKSIAAAYWKPQANSLINSLPSLTNIKGSVGGYA
KQNQHMPHGSIVSPQIGPIRVGNDNSPVVRDGRVSSSSPLAGSGIMHGSPLSDDSSHHSD
SGILNDGFSNGVANHTGPKPFDNALYSQCVLAMCTLAKDPSPRIANLGRRVLSIIGIEQV
VAKPLKSSGVRTAESTASPLARSSSWFDMNGGHLPLTFRTPPVSPPRPSYITRMRRVCSL
EFRPHLMDSPDSGLADPLLGSGGASGTSDRSFLPQSTIYSWSCGHFSKPLLTAADDSEEV
SARREEREKFALEHIAKCQHSAVSRLTNPIAKWDIKGTQTALLQPFSPIVIAADENERIR
IWNHEEATLLNSFDNHDFPDKGISKLCLVNELDESLLLAASSDGNIRIWKDYTLRGKQKL
VTAFSSIHGHKPGVRNLNAVVDWQQQCGYLYASGEISSIMLWDVDKEQLVNSKSSSSDCS
VSALAASQVHGGQFTAGFIDGSVRLYDVRTPDMLVCGLRPHTQRVEKVVGIGFQPGLDQG
KIVSASQAGDIQFLDIRNHSSAYLTIEAHRGSLTALAVHRHAPIIASGSAKQLIKVFSLE
GDQLGTIRYYPTLMAQKIGSVSCLNFHPYQVLLAAGAADACVCIYADDNTQAR
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggagatttgatggcctctcgcttttcccaatccacagttctcgtcgttccc
acctctcacaaccacctcgacgattccaccaccgcctcctcttcctcctctgctgccgcc
gccgtcgccgctcttaacaacaacagcagcagcaacgacgacgccgatttcgcgcaccgc
cgcgactctgaagccgccatcgccatcattagcagcggcaactacgccgggaatgccgcc
accagcatggcctacctgccccacaccgtcgtcctgtgcgagctccgccacgacgccttc
gaggccgccgtccccgccggcccctccgacagcggcctcgtctccaagtggcgacctaag
gacagaatgaagacaggatgtgtagctctagtattatgtttaaacattagtgtcgatcca
ccagatgtaataaagatatccccttgtgccagaatggagtgctggatagatcctttttct
atggcaccgcaaaaggcattggagtcaattggaaaaactttgagcagtcagtatgaaaga
tggcaaccaaaggcccgctataaatgtcaacttgatccgacagtggatgaggtgaagaag
ctttgtactacttgtcgtaaatatgcaaagtcggaaagagttttattccattacaatggg
catggtgtgccaaaaccaactgctaatggtgaaatttgggtcttcaataagagttataca
cagtatattcccttacctatcaatgaacttgattcctggctgaagaccccatcaatttat
gtttttgattgctctgcggctgggatgattgtgaattccttcattgagcttcatgagtgg
agtgcttccaactcctctgtgtcccaaagggattgcattctgcttgcagcatgtgaagca
catgagactttgcctcagagtgcagaattcccagctgatgtatttacatcttgccttaca
acacctataaagatggcattgcgatggttttgtactcgttcattacttcgtgaatcactt
gattattcacttatagacaagatccctggccgtccaaatgaccgaaagacacttctgggt
gaattgaattggatctttacagccgtaactgatacgattgcctggaatgttcttcctcat
gatctttttcagagactgttcagacaggatttgcttgttgcaagtctgtttcgaaatttt
ctacttgctgagcgaatcatgcgatctgcaaattgttctcctgtctctcacccaatgtta
cctccgacccatcagcatcatatgtgggatgcatgggacatggctgctgagctctgcctc
tctcaacttccgtctttagttgaggatcctaatgctgaatttcagcctagtacatttttc
actgagcagttgacagcatttgaggtatggcttgaccatggttctgaacataagaaacca
ccagaacagttgcctatagttcttcaggttttacttagtcaatgccatcggtttcgggct
ttagtactccttggaaggttccttgatatggggccatgggcagtagatctggcattatct
gttggaatatttccatatgttctaaagctgttacaaacaacaacacccgaactacgccag
atccttgtattcatatggacaaagattcttgcacttgacaagtcatgtcaggttgatcta
gtgaaggatggcggtcatatctattttattaagtttcttgatagcatggaagcatatcca
gagcaacgtgcaatggctgcttttgttttggctgtgattgtggatggtcatagacgaggc
caagaagcttgtattgaagctggtttaattcatgtctgcttaaagcaccttcagagttca
tgtcctaatgattcacaaactgaaccccttttccttcagtggctttgcctgtgtctgggg
aaattgtgggaagacttttcagaggcacaaacaatcggtttgcaggaagatgccactact
atatttgctcctctactgtctgaaccccagccagaggttagggcatctgctgtttttgca
ctaggcacccttcttgatgtggggtttgattcatgtagaagtgttggtggagatgaagaa
tgtgatgatgatgataagtttagggctgaagttagtatagttaagagtatgttagatgtt
gcttcagatgggagtccattggtgagggcagaggtagcagtggctctagcacgatttgct
tttggccacaacaagcacctgaaatctattgctgctgcatattggaagcctcaagctaat
tctttgattaattccttaccttcgttgactaatataaaaggttcggttggtggatatgct
aaacagaaccaacacatgcctcatggaagtattgtttctcctcaaattggtcctatcagg
gttggaaatgacaactctccagtggttcgagatggccgcgtctcttctagcagtcctctc
gctggttcaggaatcatgcatgggtccccattgtctgatgattcatctcatcattctgat
tcaggaattctgaatgatggtttcagcaatggagtggctaaccacactggaccaaagccc
tttgacaatgcattgtattcacaatgtgtacttgctatgtgtactttggcaaaggatcca
tctccacgcattgcaaatcttggtcgccgggtactgtccataataggtattgaacaagtg
gttgcaaaaccattgaagtctagtggtgttcggactgctgaatctacagcttctccactg
gctcgttcatcttcttggtttgacatgaatggaggacacttgcctctgaccttcagaact
cctccagtcagtcctcctcgcccaagttatataactcgaatgcgtcgagtttgttcattg
gagtttaggccccacctgatggattctccagactcaggattagctgatccactcttaggt
tctggtggagcttctgggacttcagatcgaagctttcttccacaatcaactatatatagt
tggagttgtgggcacttttccaaaccacttttaactgctgcagatgatagcgaagaggta
tcagccagaagagaagagagggaaaaatttgcattggagcacatagcaaaatgccagcac
tctgctgttagcaggctaacaaatccaattgctaaatgggacataaagggtacacaaaca
gcattgctgcaacctttctctcctatagtgatagctgctgatgagaatgaacgtatcagg
atatggaaccatgaggaggcaacactactgaacagttttgataatcatgattttcctgac
aaaggaatttctaagctctgccttgtaaatgagcttgatgagagcttgcttcttgctgct
tcatctgatggaaacattcggatttggaaagattatactctgaggggtaaacaaaaactt
gtcactgcattctcttcaattcatggtcataaacctggtgtgaggaatctgaatgcagtt
gttgattggcaacaacaatgtggttatctgtatgcatcgggtgagatatcatctattatg
ctatgggatgttgataaagagcagcttgtcaattctaaatcttcatcatcagattgcagt
gtctcagcattggctgcatctcaagttcatgggggacaatttacagctggtttcatagat
ggttctgtccgactttatgatgtcagaacacctgatatgctcgtttgtggattaaggcct
catacacaaagagtagaaaaggttgtggggattggctttcagcctggattagaccaagga
aagattgttagcgcttctcaggctggggatatccaatttcttgatataagaaatcatagc
agtgcctatcttactattgaagctcataggggttcactcacagctttagcagtacataga
catgccccaattattgccagtggttcagcgaaacaactcattaaggtctttagcctggag
ggtgatcaactaggcaccattcgatactatcctaccctaatggcccagaaaattggttct
gtaagctgcctcaatttccatccataccaagtattacttgctgctggtgctgcagatgca
tgtgtttgtatttatgctgatgacaacactcaagctagatga

DBGET integrated database retrieval system