KEGG   Glycine max (soybean): 100777287Help
Entry
100777287         CDS       T01710                                 

Definition
beta-galactosidase-like
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100777287
  Lipid metabolism
   00600 Sphingolipid metabolism
    100777287
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100777287
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100777287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 1121 aa AA seqDB search
MMASSSLVVVGSLHLTSQNGYKVWEDPSFIKWRKRDPHVTLHCHESLEGSLKYWYQRNKV
DFLASQSAVWNDDAVQGSLDCAAFWVKDLPFVKSLSGYWKFFIADSPNNVPTYFYESEFQ
DSGWKTLPVPSNWQLHGFDTPIYTNVVYPFPLDPPFIPVENPTGCYRTYFHIPKEWEGRR
VLLHFEAVDSAFCAWINGHPVGYSQDSRLPAEFEITDFCHPCGSDLKNVLAVQVFRWCDG
SYLEDQDQWRLSGIHRDVLLMAKPEVFITDYFFKSNLAEDFSCAEIMVEVKIDRLQETSK
DNVLTNYSIEATLFDSGSWYTSDGNPDLLSSNVADIKLQSSSAPAQPLGFHGYVLTGKLK
SPKLWSAEKPYLYTLVVVLKDRSGRIVDCESCPVGFRKVSKAHKQLLVNGHAVVIRGVNR
HEHHPQVGKANIESCMIKDLVLMKQNNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIE
THHFDYSKHLKHPTMEPKWATSMLDRVIGMVERDKNHTCIISWSLGNESGFGTNHFALAG
WIRGRDSSRVLHYEGGGSRTPCTDIVCPMYMRVWDMVKIANDPTETRPLILCEYSHAMGN
SNGNLHIYWEAIDNTFGLQGGFIWDWVDQALVKVYEDGTKHWAYGGEFGDVPNDLNFCLN
GLTFPDRTPHPVLHEVKYLYQPIKVALKEGKLEIKNTHFFQTTEGLEFSWSISADGYNLG
SGLLGLVPIKPQSSHAVDWQSGPWYSLWASTDEEELFLTITAKLLNSTRWVEAGHIVSSA
QVQLPTRRNIAPHVIDINGGTLVAETLGDTIVVKQQDAWDLTLNTKTGLVESWKVKGVHV
MKKGILPCFWRAPIDNDKGGGSASYLSRWKAAGMDCLHFITESCSVQNITENSVRILVVF
LGVTKGEDGSLSNQDKSKVLFTTEMAYTIYASGDVIIECNVKPNPDLPPLPRVGIELNVE
KSLDQVTWYGRGPFECYPDRKAAALVAVYEHNVSELHVPYIVPGESSGRADVRWATFRNK
DAFGIYASKYGSSPPMQMSASYYSTSELDRATHNEELIEGDSIEIHLDHKHMGLGGDDSW
SPCVHEQYLIPPVPYSFSVRLCPVNPATSGHDIYKSQFQNS
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcttcttctttggttgttgttggctctctccatcttacttcacagaatggt
tacaaagtgtgggaagatccttctttcatcaagtggaggaaaagggaccctcatgttacc
ttgcattgccatgaatctcttgaaggatctcttaaatattggtatcaacgcaataaagtg
gattttttggcttcccagtcagctgtttggaatgatgatgctgttcaggggtctcttgac
tgtgctgcattttgggtcaaagatttgccttttgtcaagtccttgtctggatattggaaa
tttttcattgctgacagtcccaacaatgtccctacttatttttatgaaagtgagttccag
gattcagggtggaaaactttgccagttccttcgaattggcagttacatggatttgacact
cctatatatacgaacgtggtgtatccatttccactagatcctcctttcattcctgtggaa
aatcctactggctgttacagaacgtacttccacattcctaaagaatgggagggtagaaga
gttttgttgcattttgaagcagttgattctgccttttgtgcatggataaatgggcatcct
gttggatatagccaagacagcagactacctgcagagtttgaaattaccgatttttgccat
ccctgtggttcagaccttaagaatgttttagccgttcaagtgtttagatggtgtgatggt
tcttaccttgaagaccaggaccaatggaggttatctggtatccaccgtgatgttcttctt
atggcaaagccggaggtatttattactgactactttttcaaatcaaaccttgccgaagat
ttttcttgcgcagagataatggttgaagtaaaaatagatagattacaagagacatccaag
gataatgttctcacaaactactctatagaagctacattgtttgattctggaagctggtac
acctctgacgggaatcctgatctcctttcatctaacgtggcagacataaagctccaatca
tcaagtgcaccagcacaaccattagggtttcatggctatgttcttacagggaaactgaaa
tcgccaaagctttggtccgcagaaaaaccatacctctataccctagttgttgtcctgaaa
gatagatctggccgcattgttgactgtgaatcatgtccagtagggtttagaaaagtatct
aaagcccacaaacaactgcttgttaatggacatgcagttgtaataagaggtgtgaacagg
catgaacatcatccacaagtggggaaggcaaacatagaatcctgcatgatcaaggatttg
gtcttaatgaagcaaaacaatattaatgctgtgaggaacagccattatccccaacatcca
cgttggtatgagctatgtgatttgtttggcatgtacatgatagatgaagccaatattgag
acacatcattttgactattctaaacatctcaagcatcccactatggaaccaaagtgggca
acttcaatgctggatcgtgtgatcggcatggttgagagagataaaaatcacacatgtatt
atctcctggtctttagggaatgaatctggatttggaacaaatcattttgctttagctggt
tggattcggggaagagattcatctcgggtattgcattatgaaggaggtggatccaggact
ccgtgcactgatattgtgtgtcctatgtatatgcgtgtttgggacatggtgaaaatagcc
aatgatccaactgaaacacgtcctctgatactgtgcgagtattcacatgcaatgggaaac
agtaatgggaatctacatatatattgggaagcaattgacaacacttttggactccaagga
ggctttatttgggattgggttgatcaagccttggtgaaagtttatgaagatggtaccaag
cattgggcatatggaggtgaatttggggatgttcccaatgacttgaatttctgtttgaat
ggcctcacatttcctgatcgaactcctcatcctgttttacatgaggttaagtacttatac
caaccaatcaaggtggctttaaaggaaggaaaattggagataaaaaatactcattttttt
caaacaacagaaggattggagttcagctggtctatttctgcagatggatacaaccttgga
tctggtcttttgggccttgtccctataaagccccagagtagtcatgctgttgattggcaa
tcaggtccatggtattccctatgggcttcaacagatgaagaagaactattcctgactata
acagctaaacttttgaactccacacgctgggttgaagctggtcatattgtttcatctgct
caagttcaattgcctaccaggagaaacattgcacctcatgttattgatattaatggtggc
actctggttgctgaaacactaggagatacaatcgtagtcaaacagcaagatgcttgggat
ttgactttgaatactaaaacaggtttagttgaaagctggaaggttaaaggagtgcatgtt
atgaaaaagggcatcctcccatgtttctggcgagctcctatcgataatgacaaaggagga
ggttcagccagttatttgtccaggtggaaagcagctggaatggactgcctccactttatt
actgagagctgttctgtgcaaaatattacggagaactcagttagaatattggtggttttt
cttggtgttaccaagggcgaggatggttctctctccaaccaagacaagtcaaaggtttta
tttacaacagaaatggcatatacaatttatgcttctggggatgtcattatagaatgcaat
gtgaaaccaaaccctgatcttcctcctttgccacgtgtgggaatcgagttaaatgtggaa
aagtctttggatcaagtaacttggtatggaagaggaccatttgagtgttatccagataga
aaagctgcagccctggttgcagtctatgaacataatgttagtgagttgcatgttccttat
attgttccgggggaatcttcaggtagggcagatgttagatgggcaacattcagaaacaaa
gatgcttttggaatatatgcttctaagtatggtagctctccacccatgcaaatgagtgca
agttactacagcacctcggaacttgaccgtgcgacacacaatgaagagctcattgaagga
gatagcattgagattcatctagatcacaagcacatgggattgggtggagatgatagttgg
tcgccatgtgtccacgaacagtatttgattcctcctgtgccatactcattctctgttagg
ctgtgcccagtaaatccagccacttctggtcatgacatctacaaatcccagtttcaaaac
tcttga

DBGET integrated database retrieval system