KEGG   Glycine max (soybean): 100777366Help
Entry
100777366         CDS       T01710                                 

Definition
AMSH-like ubiquitin thioesterase 1-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100777366
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100777366
Peptidases [BR:gmx01002]
 Metallo Peptidases
  Family M67
   100777366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 520 aa AA seqDB search
MRSSSSSDRNRINIAASAQKVDVDNRISLRFYYRIADNILRQADIFRAEKNIIDLYVMLL
RFSSLVSETIPRHRDYRSSPQRQKESLKKKLLISLNELENLKPVVQQKINELNNKFAYQQ
NGQGKFISNNSLDFSPVKKLTSASYGLIKAVRPTAGEFVYQGSRSQQFSYVRPVEEHVRR
LSLTLPPPKEETLSRHSILGPNGLKGHWRPPIIDKGIKYPSNIDLSPVELPSLQQSMEDE
SLKKKDNSIAEHHKSELASILTQSEDCQLQPHPQPEPDQEPPSLISFETTETSAQIEVIR
QPSPPPVLAEVQDLVPAVSPCVNEAGCKTEIPSLDNSVHAEDPLQLHISAALMESFMKLA
KSNTKKNLETCGVLAGLLKNRKFYITALIIPKQESTSDSCQTTNEEEIFEVQDKRSLFPL
GWIHTHPTQSCFMSSIDLHTHYSYQIMLPESVAIVMAPRDSSRNHGIFRLTTPGGMSVIK
QCDQRGFHPHSQPPDGGPIYKTCTDVYMNPDLKFEVIDLR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcttcttcttcttcggacaggaacaggatcaacatcgctgccagtgctcagaaa
gtcgatgtcgataaccgaatctccctccgattctactaccgcatcgctgacaacatcctc
cgacaggctgatatctttcgtgcagagaagaatattattgacctatatgtcatgctttta
agattttctagtttggtgtctgagacaataccacgccaccgagactatagatcatctcca
caaaggcagaaagaatcattgaaaaagaaattgttaatttcgttgaatgaactggagaac
ttgaaaccagtggtccaacagaagatcaatgagcttaacaacaaatttgcataccaacaa
aatggacagggaaaatttatttcaaataattcactggatttttctcctgtgaaaaagcta
acttcggctagttatggcctaataaaggcagtcagacctactgctggggagtttgtttac
caaggatcaaggagccaacagttctcttatgtcaggcctgtggaagagcatgtacgaaga
ctatctctaactcttccacctccaaaggaggaaactctctcaagacattctatccttggt
cccaacgggctaaaagggcattggagaccacctatcattgataaagggatcaagtatcca
agcaacatagatctatcccctgttgaattaccgagcctacaacagtccatggaagatgaa
tctctgaaaaagaaagataacagcattgcagaacaccataaatcagagttagcttcaatt
ctaacccaaagtgaggactgccagctgcagccccatccccagcctgagcctgaccaggag
cctccttctcttatttcttttgaaacaacagaaacctctgctcaaatagaagttatcaga
caaccttctcctccacctgtacttgctgaagtacaagatttggtccctgcagtgtcacct
tgtgttaatgaggcagggtgtaagacagagattccgtcattagataatagtgttcatgcc
gaggatcctctacaactgcacatttcagctgctttgatggagagttttatgaagcttgcc
aagtcgaatacaaaaaaaaatttagagacttgcggtgtccttgctggtttgcttaaaaac
agaaaattttatattactgcccttataatcccaaagcaggagtcaacatcagattcttgt
cagactacaaatgaagaggaaatatttgaagtgcaagataaacggtctctttttcccctt
gggtggatccatacacatcctacacaatcttgttttatgtcgtccattgatctgcacacc
cattactcctatcagattatgctgccagaatctgttgcaatagtcatggcgccaagagat
agttcgagaaaccatggcatttttcggttgacaacccccggtggaatgtctgtgattaaa
caatgtgatcaacgtggctttcatccacatagtcagcctccagatggtggtcctatttac
aagacatgtacagatgtatacatgaacccagatttaaaatttgaggtcattgatcttcga
tga

DBGET integrated database retrieval system