KEGG   Glycine max (soybean): 100777616Help
Entry
100777616         CDS       T01710                                 

Definition
(RefSeq) nuclear pore complex protein NUP205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100777616
Messenger RNA biogenesis [BR:gmx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100777616
Chromosome [BR:gmx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100777616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1887 aa AA seqDB search
MVSPKQLLGTIESALLGTSPPMAAHRVELLHALRTSRTSLQSLLSYPPPKPSDRSQVQSK
SVRLPDSPPISLDDQDVHIALKLSDDLHLNEVDCVRLLVSANKEWGLMGREPLEILRLAA
GLWYTERRDLITSLHLLLRAVVLDQGLQDDILVDIQKYLEDLISSGLRQRLISLIKELNR
EEPSGLGGPQCESYVLDSRGSLVERQAVVSRERLILGHCLVLSILVVRTCPKDIKDIFSV
LKDSASEVSESNATVKHQITFCLLFALVIAFVSDGLSTVPDKASVLSSNTSFRHEFHELV
MTTGNDPHVEGFVGGIRLAWVVHLMLIQDGVPARETISSGSSNELGYLSQCLEAIFSNNV
FQFLLDKVLRTASFQTEDEDMIYMYNAYLHKLITCFLSNPLARDKIKESKERIMSVLSPY
RVVGSHDFAQDSNSSSLHGTEMGPLPFNSILDFVSEIYQKEPELLSGNDVLWTFVNFAGE
DHTNFQTLVAFLNMLSTLACSQEGASKVYELLQGKAFRSIGWSTLFECLTIYDEKFKQSL
QTAGAMLPEIQEGDAKALVAYLNILKKVVENGNPTERKTWFPDIEPLFKLLSYENVPPYL
KGALRNAIATFIKVSPVLKDSIWTYLEQYDLPVVVGLDIPNSPQSMGTQVYDMQFELNEI
EARREQYPSTISFLNLINALIAEERDLSDRGRRFIGIFRFIYDHVFGPFPQRAYADPCEK
WQLVGACLKHFHMVLSMYDIKDEDYEGVVDQSRLSATKESSPLQTQLPVLELLKDFMSGK
TAFRNIMSILLPGVNSVIAERSSQLYGQLLENAVQLSLEIIILVLDKDLLLSDYWRPLYQ
PLDIILSHDHNQIVALLEYVRYDFQPKVQQSSIKIMSILSSRMVGLVQLLLKSNASNSLI
EDYAACLELRSEELQNLENNNDDPGILIMQLLIDNISRPAPNITHLLLKFDLDTPIERTV
LQPKFYYSCMKVILDILEKLLKPGVNALLHEFGFQLLYELCVDPLTSGPTMDLLSNKKYL
FFVKHLDTIGIAPLPKRNSNQSLRNSSLHQRAWLLKLLAVELHAGDVRSSNHREACQTIL
SYLFAHGLNDIGGGQAMPPFLLHDTSENAAIRTVSKSKVLELLEIIQFRCPDSTTQLSNI
VAGMKYDLPAEDILGNPGNSGKGGVYYYSERGDRLIDLASFHDKLWQKYNSAYAQASNLG
SEVELNNVRETIQQLLRWGWKYNKNLEEQAAQLHMLTAWSQIVEVSASRRLTMLEDRSEI
LFQVLDVSLSASASPDCSLRMAFILSQVALTCMAKLRDERFLFPGSLSSDNITCLDLIVV
KQLSNGACLTILFKLIMAILRNESSEALRRRQYALLLSYFQYCQNVVDPDVPTTVLQFLL
LSEQDNEYIDLPKIDKEQAELARANFSTLRKEAQSILNLVVKDATHGSEPGKTISLYVLD
ALINIDHERFFLSQLQSRGFLRSCFTAISNVCNQDGSLSLDSLQRACTFEAELALLLRIS
HKYGKSGAQILFSMGILEHLASGRAINLQGSLRWVETRLRRDMAVDVDRQRMIITPVLRL
VFSLTSLVDTSDFLEVKNKIVREVIDFIKGHQSLFDQVLRLDIAEADELRTEQVNLVVGI
LSKVWPYEESNEYGFVQGLFGLMHALFSRDSKIPSFAQSRVSPENQRNSELQMFNLCYSL
SSYLYFLVTKKSLRLQPSDASSSYAASVELQQPTLSLLNSLLFSVTTAFERAAEEKSLLL
NKIRDINELSRQEVDEIINMCVRQDSVSSSDNIHKRRYIAMVEMCRVVASRDQLIILLLP
LSEHVLNIILIHLQESSVALDSTLSTKTIAYGAKYDAQQDVAMLYGKLVPTLERLELLSE
EKVGHNLKVFRRLATSAKDLAIQKLIV
NT seq 5664 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctccgaagcagctcctgggcaccatcgaatctgcgcttctcggcacttcgcct
ccgatggcggcgcaccgcgtcgaactcttgcacgctctccgcacttctcgaacctccttg
cagtcccttctctcgtatccccccccaaagccctctgatcgaagtcaagttcagtcaaag
tcagtcagacttcctgattctcctcctatttcacttgatgaccaggatgttcacattgcg
ctcaaattgagtgacgatctccatctcaatgaagtagattgtgttcgtttgcttgtatca
gctaataaagagtggggcttaatgggaagggaaccactggaaattttacggcttgcagca
ggactctggtatacagagagaagagatttgataacgtccctccatttgctcttaagggct
gtggtgctagatcagggactgcaagatgatatattggtagacattcaaaagtatttggaa
gatcttatcagttctggacttagacagcggttgatttctcttatcaaggaactcaataga
gaagagccttctggtttgggtggtcctcagtgtgagagttatgttcttgattcaagaggc
tctcttgtggagaggcaggcagtggtctctagagaaagacttattctggggcattgtctt
gtgctttcgattctggttgttcggacatgcccgaaggatataaaagatattttttctgtt
ttgaaggatagtgcttctgaagttagtgagagcaatgccactgtaaaacatcagattacc
ttttgtcttctctttgctcttgtgattgcttttgtttctgatggtttgagtacagtgcct
gataaagcatctgtcctttcttctaatacttccttcagacacgaatttcatgaacttgta
atgactactgggaatgatccacatgttgagggctttgttggtggcataaggcttgcttgg
gtggtacatttgatgttaatacaagatggtgttccagctagagagactatttcaagtggt
tcatcaaatgaactgggttatcttagtcaatgcttggaagccattttctcaaataatgtt
tttcagtttttacttgataaagttcttcgtactgcttccttccagactgaagacgaagat
atgatctacatgtacaatgcttatctgcacaagctgattacgtgcttcttgtctaaccct
cttgcaagagacaagataaaagaatccaaggagcggattatgagtgtgcttagtccatac
cgagttgtgggatcacatgattttgcacaggacagtaattcaagttctctacatggcact
gagatgggccctttaccatttaattcaatcttggactttgtgagcgaaatttatcagaaa
gaaccagagctcttgtcgggcaatgatgtgttgtggacgtttgtaaattttgctggagag
gaccatacgaatttccaaacgcttgtggcgttcttgaatatgctgagcaccttggcttgt
agtcaagaaggtgcttcaaaggtttacgagttgctgcaaggtaaagcattccgttcaatt
ggatggagcactttatttgaatgcttaacaatttatgatgagaaattcaaacagtctctt
caaactgcgggagcaatgctgcctgaaattcaggagggggatgccaaagcccttgtggca
tacttgaatattctaaagaaggttgtagaaaatgggaacccaacagaaaggaaaacctgg
tttcctgatattgaaccattgttcaaacttcttagttacgaaaatgtacccccttatctt
aagggtgctctaaggaatgcaatagccacatttattaaggtctctccagtgctgaaggat
agcatctggacctatcttgagcaatatgatctgccagtggttgttgggcttgatatccca
aacagtccacaatctatgggtactcaggtttatgatatgcaatttgaactgaacgagatt
gaagcaaggagagaacaatatccttcaactatatctttccttaatttgataaatgctcta
attgcagaagaaagagatttgtctgatagagggcgaagatttattggaatatttaggttc
atctatgatcatgtttttgggccatttcctcagagagcctatgcggatccctgtgaaaaa
tggcagttagttggtgcatgccttaaacattttcacatggtattaagcatgtacgacatc
aaggatgaggactacgagggtgtagttgatcagtcacgactttcagcaactaaagaatca
tcaccacttcagacacagctcccagttttagagttgctgaaagatttcatgagtggaaag
actgccttccggaacataatgagtattcttctgccaggggtgaattctgttattgctgaa
cgcagtagtcaattatatgggcaacttttagagaatgcagtgcagctttctctggaaatt
ataatccttgtccttgacaaagatttacttctttctgattattggcgtcctctataccag
ccattagatattatactctcccatgatcataatcaaatagtggccctgttggagtatgtc
agatatgattttcagccaaaagttcagcaatcctccatcaaaatcatgagtattttaagc
tctcgcatggttgggcttgttcaactattgctaaaatctaatgcatcaaacagcttgata
gaagattatgcagcctgccttgagttacggtcagaagagcttcagaatcttgaaaataac
aatgatgatccaggcattcttattatgcaacttctaattgacaatatcagccggccagcc
cctaatatcactcatttactgcttaaatttgatctagacacacctattgagcggacagtt
ttacagcctaaattttattacagttgcatgaaggttattcttgatatcctggaaaagctt
ttgaagcctggtgtaaatgcattacttcatgaatttggttttcagctgctttatgaattg
tgtgtagatccactaacaagtggaccaacaatggatctgttgtcaaataaaaagtaccta
ttctttgttaagcaccttgatacaattggtattgccccacttcctaaacgaaatagcaac
cagtcacttcgaaacagttcccttcatcagagagcatggcttttgaaacttttagcggtt
gaactacatgctggtgatgttaggagctccaatcatagagaagcatgtcagacaatcctt
tcttatctttttgcccatggtcttaatgacattggtgggggccaggccatgcctccattt
ttgcttcatgatacttctgaaaatgctgctataagaactgtcagcaagagtaaggtatta
gaattgcttgaaatcattcagtttagatgtccagattccactactcagctctcaaatatt
gtggctggtatgaaatatgacttgccggcagaagacatacttggaaatccgggaaattcc
ggaaagggtggtgtgtactattattccgagagaggtgatcggctaattgaccttgcttct
ttccatgacaaactttggcagaaatataattcagcatatgcccaggcaagtaaccttggc
agtgaagttgaacttaataatgttcgtgagacaattcaacagttgctgagatggggttgg
aaatacaataaaaatcttgaggaacaagctgcacaacttcatatgttgactgcttggtct
cagattgttgaggtgtctgcttctagaagattaacaatgcttgaagatcgatctgaaatt
ctttttcaggtccttgatgtgtctcttagtgcatctgcttctcctgactgttcattgagg
atggcattcatactatcacaggtagcattgacatgcatggctaagctgcgagatgaaaga
tttttgttccctggcagtctgagttctgataacatcacatgccttgatctcattgtggtg
aagcaattatcaaatggtgcttgtctgaccatattgtttaagcttatcatggcaattctt
agaaatgaatcttcagaagctcttaggagacgtcaatatgctctacttcttagctatttc
cagtattgccaaaatgtggttgatcctgatgttccaaccaccgttcttcaattcttgctg
ctcagtgaacaagataatgaatatattgatctcccaaagattgacaaagaacaagcagaa
ctggctcgtgcaaacttttcaactttgaggaaagaagctcagagcattttgaatctggtc
gtaaaagatgcaacccatggtagtgaacctggaaagacaatatcactttatgttcttgat
gcattgattaatatagatcatgagcgctttttcttgagccaacttcaaagcaggggtttt
ttaaggtcttgctttacagccataagcaatgtttgcaatcaggatggtagtctttcactg
gactcattgcagagggcatgcacttttgaggctgaacttgctttactactaagaatcagt
cacaagtatggaaaatccggagcacagattttattttccatgggcatattggagcatctt
gcatctggcagagcaatcaatttacagggaagtttaaggtgggttgagacaagacttaga
agagatatggctgtggatgttgatagacaacggatgattattactccagtcttgagatta
gtgttttcactaacttccttggttgatacatctgactttttggaggttaagaataaaatt
gtccgtgaagtaatcgattttatcaaagggcatcaatcactgtttgatcaagttctccgt
ttagacattgccgaggcagatgaactaagaacagagcaggtcaatttagttgttggtatt
cttagcaaggtttggccatatgaagagagcaatgagtacggttttgttcaagggcttttt
ggtctgatgcatgctcttttctcacgtgattcaaagattcctagttttgctcaatcaaga
gtatcacctgagaatcagaggaattcagaactacagatgtttaatttgtgctacagcctg
agctcttacttgtattttctagtcacaaagaaatccctgagattacagccttcagatgcc
tcttccagttacgctgcttctgttgaacttcaacaacccacattgagcttgcttaattct
cttcttttttctgtcacaactgcttttgaaagggcagctgaggagaaatccttgttactg
aataagattcgagacataaatgaactgtcaaggcaggaagttgatgaaatcatcaatatg
tgtgtccggcaagactctgtttcatcttcagataacatacataaaaggaggtacattgca
atggtagaaatgtgtcgagttgttgctagtagggatcagctaatcattttattactgcca
ctctctgaacatgtgctaaatatcatccttatccatcttcaagagagctctgttgcactc
gattctaccttgagtacaaaaacaattgcatatggtgccaaatatgatgcacaacaggac
gttgctatgttatatggaaagttagttccaacccttgagcgacttgagttgctgagtgag
gagaaagtagggcacaatctcaaagtattccgcagattagcaacttctgccaaagatctt
gcaattcaaaaattgattgtgtag

DBGET integrated database retrieval system