KEGG   Glycine max (soybean): 100777616Help
Entry
100777616         CDS       T01710                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100777616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1887 aa AA seqDB search
MVSPKQLLGTIESALLGTSPPMAAHRVELLHALRTSRTSLQSLLSYPPPKPSDRSQVQSK
SVRLPDSPPISLDDQDVHIALKLSDDLHLNEVDCVRLLVSANKEWGLMGREPLEILRLAA
GLWYTERRDLITSLHLLLRAVVLDQGLQDDILVDIQKYLEDLISSGLRQRLISLIKELNR
EEPSGLGGPQCESYVLDSRGSLVERQAVVSRERLILGHCLVLSILVVRTCPKDIKDIFSV
LKDSASEVSESNATVKHQITFCLLFALVIAFVSDGLSTVPDKASVLSSNTSFRHEFHELV
MTTGNDPHVEGFVGGIRLAWVVHLMLIQDGVPARETISSGSSNELGYLSQCLEAIFSNNV
FQFLLDKVLRTASFQTEDEDMIYMYNAYLHKLITCFLSNPLARDKIKESKERIMSVLSPY
RVVGSHDFAQDSNSSSLHGTEMGPLPFNSILDFVSEIYQKEPELLSGNDVLWTFVNFAGE
DHTNFQTLVAFLNMLSTLACSQEGASKVYELLQGKAFRSIGWSTLFECLTIYDEKFKQSL
QTAGAMLPEIQEGDAKALVAYLNILKKVVENGNPTERKTWFPDIEPLFKLLSYENVPPYL
KGALRNAIATFIKVSPVLKDSIWTYLEQYDLPVVVGLDIPNSPQSMGTQVYDMQFELNEI
EARREQYPSTISFLNLINALIAEERDLSDRGRRFIGIFRFIYDHVFGPFPQRAYADPCEK
WQLVGACLKHFHMVLSMYDIKDEDYEGVVDQSRLSATKESSPLQTQLPVLELLKDFMSGK
TAFRNIMSILLPGVNSVIAERSSQLYGQLLENAVQLSLEIIILVLDKDLLLSDYWRPLYQ
PLDIILSHDHNQIVALLEYVRYDFQPKVQQSSIKIMSILSSRMVGLVQLLLKSNASNSLI
EDYAACLELRSEELQNLENNNDDPGILIMQLLIDNISRPAPNITHLLLKFDLDTPIERTV
LQPKFYYSCMKVILDILEKLLKPGVNALLHEFGFQLLYELCVDPLTSGPTMDLLSNKKYL
FFVKHLDTIGIAPLPKRNSNQSLRNSSLHQRAWLLKLLAVELHAGDVRSSNHREACQTIL
SYLFAHGLNDIGGGQAMPPFLLHDTSENAAIRTVSKSKVLELLEIIQFRCPDSTTQLSNI
VAGMKYDLPAEDILGNPGNSGKGGVYYYSERGDRLIDLASFHDKLWQKYNSAYAQASNLG
SEVELNNVRETIQQLLRWGWKYNKNLEEQAAQLHMLTAWSQIVEVSASRRLTMLEDRSEI
LFQVLDVSLSASASPDCSLRMAFILSQVALTCMAKLRDERFLFPGSLSSDNITCLDLIVV
KQLSNGACLTILFKLIMAILRNESSEALRRRQYALLLSYFQYCQNVVDPDVPTTVLQFLL
LSEQDNEYIDLPKIDKEQAELARANFSTLRKEAQSILNLVVKDATHGSEPGKTISLYVLD
ALINIDHERFFLSQLQSRGFLRSCFTAISNVCNQDGSLSLDSLQRACTFEAELALLLRIS
HKYGKSGAQILFSMGILEHLASGRAINLQGSLRWVETRLRRDMAVDVDRQRMIITPVLRL
VFSLTSLVDTSDFLEVKNKIVREVIDFIKGHQSLFDQVLRLDIAEADELRTEQVNLVVGI
LSKVWPYEESNEYGFVQGLFGLMHALFSRDSKIPSFAQSRVSPENQRNSELQMFNLCYSL
SSYLYFLVTKKSLRLQPSDASSSYAASVELQQPTLSLLNSLLFSVTTAFERAAEEKSLLL
NKIRDINELSRQEVDEIINMCVRQDSVSSSDNIHKRRYIAMVEMCRVVASRDQLIILLLP
LSEHVLNIILIHLQESSVALDSTLSTKTIAYGAKYDAQQDVAMLYGKLVPTLERLELLSE
EKVGHNLKVFRRLATSAKDLAIQKLIV
NT seq 5664 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctccgaagcagctcctgggcaccatcgaatctgcgcttctcggcacttcgcct
ccgatggcggcgcaccgcgtcgaactcttgcacgctctccgcacttctcgaacctccttg
cagtcccttctctcgtatccccccccaaagccctctgatcgaagtcaagttcagtcaaag
tcagtcagacttcctgattctcctcctatttcacttgatgaccaggatgttcacattgcg
ctcaaattgagtgacgatctccatctcaatgaagtagattgtgttcgtttgcttgtatca
gctaataaagagtggggcttaatgggaagggaaccactggaaattttacggcttgcagca
ggactctggtatacagagagaagagatttgataacgtccctccatttgctcttaagggct
gtggtgctagatcagggactgcaagatgatatattggtagacattcaaaagtatttggaa
gatcttatcagttctggacttagacagcggttgatttctcttatcaaggaactcaataga
gaagagccttctggtttgggtggtcctcagtgtgagagttatgttcttgattcaagaggc
tctcttgtggagaggcaggcagtggtctctagagaaagacttattctggggcattgtctt
gtgctttcgattctggttgttcggacatgcccgaaggatataaaagatattttttctgtt
ttgaaggatagtgcttctgaagttagtgagagcaatgccactgtaaaacatcagattacc
ttttgtcttctctttgctcttgtgattgcttttgtttctgatggtttgagtacagtgcct
gataaagcatctgtcctttcttctaatacttccttcagacacgaatttcatgaacttgta
atgactactgggaatgatccacatgttgagggctttgttggtggcataaggcttgcttgg
gtggtacatttgatgttaatacaagatggtgttccagctagagagactatttcaagtggt
tcatcaaatgaactgggttatcttagtcaatgcttggaagccattttctcaaataatgtt
tttcagtttttacttgataaagttcttcgtactgcttccttccagactgaagacgaagat
atgatctacatgtacaatgcttatctgcacaagctgattacgtgcttcttgtctaaccct
cttgcaagagacaagataaaagaatccaaggagcggattatgagtgtgcttagtccatac
cgagttgtgggatcacatgattttgcacaggacagtaattcaagttctctacatggcact
gagatgggccctttaccatttaattcaatcttggactttgtgagcgaaatttatcagaaa
gaaccagagctcttgtcgggcaatgatgtgttgtggacgtttgtaaattttgctggagag
gaccatacgaatttccaaacgcttgtggcgttcttgaatatgctgagcaccttggcttgt
agtcaagaaggtgcttcaaaggtttacgagttgctgcaaggtaaagcattccgttcaatt
ggatggagcactttatttgaatgcttaacaatttatgatgagaaattcaaacagtctctt
caaactgcgggagcaatgctgcctgaaattcaggagggggatgccaaagcccttgtggca
tacttgaatattctaaagaaggttgtagaaaatgggaacccaacagaaaggaaaacctgg
tttcctgatattgaaccattgttcaaacttcttagttacgaaaatgtacccccttatctt
aagggtgctctaaggaatgcaatagccacatttattaaggtctctccagtgctgaaggat
agcatctggacctatcttgagcaatatgatctgccagtggttgttgggcttgatatccca
aacagtccacaatctatgggtactcaggtttatgatatgcaatttgaactgaacgagatt
gaagcaaggagagaacaatatccttcaactatatctttccttaatttgataaatgctcta
attgcagaagaaagagatttgtctgatagagggcgaagatttattggaatatttaggttc
atctatgatcatgtttttgggccatttcctcagagagcctatgcggatccctgtgaaaaa
tggcagttagttggtgcatgccttaaacattttcacatggtattaagcatgtacgacatc
aaggatgaggactacgagggtgtagttgatcagtcacgactttcagcaactaaagaatca
tcaccacttcagacacagctcccagttttagagttgctgaaagatttcatgagtggaaag
actgccttccggaacataatgagtattcttctgccaggggtgaattctgttattgctgaa
cgcagtagtcaattatatgggcaacttttagagaatgcagtgcagctttctctggaaatt
ataatccttgtccttgacaaagatttacttctttctgattattggcgtcctctataccag
ccattagatattatactctcccatgatcataatcaaatagtggccctgttggagtatgtc
agatatgattttcagccaaaagttcagcaatcctccatcaaaatcatgagtattttaagc
tctcgcatggttgggcttgttcaactattgctaaaatctaatgcatcaaacagcttgata
gaagattatgcagcctgccttgagttacggtcagaagagcttcagaatcttgaaaataac
aatgatgatccaggcattcttattatgcaacttctaattgacaatatcagccggccagcc
cctaatatcactcatttactgcttaaatttgatctagacacacctattgagcggacagtt
ttacagcctaaattttattacagttgcatgaaggttattcttgatatcctggaaaagctt
ttgaagcctggtgtaaatgcattacttcatgaatttggttttcagctgctttatgaattg
tgtgtagatccactaacaagtggaccaacaatggatctgttgtcaaataaaaagtaccta
ttctttgttaagcaccttgatacaattggtattgccccacttcctaaacgaaatagcaac
cagtcacttcgaaacagttcccttcatcagagagcatggcttttgaaacttttagcggtt
gaactacatgctggtgatgttaggagctccaatcatagagaagcatgtcagacaatcctt
tcttatctttttgcccatggtcttaatgacattggtgggggccaggccatgcctccattt
ttgcttcatgatacttctgaaaatgctgctataagaactgtcagcaagagtaaggtatta
gaattgcttgaaatcattcagtttagatgtccagattccactactcagctctcaaatatt
gtggctggtatgaaatatgacttgccggcagaagacatacttggaaatccgggaaattcc
ggaaagggtggtgtgtactattattccgagagaggtgatcggctaattgaccttgcttct
ttccatgacaaactttggcagaaatataattcagcatatgcccaggcaagtaaccttggc
agtgaagttgaacttaataatgttcgtgagacaattcaacagttgctgagatggggttgg
aaatacaataaaaatcttgaggaacaagctgcacaacttcatatgttgactgcttggtct
cagattgttgaggtgtctgcttctagaagattaacaatgcttgaagatcgatctgaaatt
ctttttcaggtccttgatgtgtctcttagtgcatctgcttctcctgactgttcattgagg
atggcattcatactatcacaggtagcattgacatgcatggctaagctgcgagatgaaaga
tttttgttccctggcagtctgagttctgataacatcacatgccttgatctcattgtggtg
aagcaattatcaaatggtgcttgtctgaccatattgtttaagcttatcatggcaattctt
agaaatgaatcttcagaagctcttaggagacgtcaatatgctctacttcttagctatttc
cagtattgccaaaatgtggttgatcctgatgttccaaccaccgttcttcaattcttgctg
ctcagtgaacaagataatgaatatattgatctcccaaagattgacaaagaacaagcagaa
ctggctcgtgcaaacttttcaactttgaggaaagaagctcagagcattttgaatctggtc
gtaaaagatgcaacccatggtagtgaacctggaaagacaatatcactttatgttcttgat
gcattgattaatatagatcatgagcgctttttcttgagccaacttcaaagcaggggtttt
ttaaggtcttgctttacagccataagcaatgtttgcaatcaggatggtagtctttcactg
gactcattgcagagggcatgcacttttgaggctgaacttgctttactactaagaatcagt
cacaagtatggaaaatccggagcacagattttattttccatgggcatattggagcatctt
gcatctggcagagcaatcaatttacagggaagtttaaggtgggttgagacaagacttaga
agagatatggctgtggatgttgatagacaacggatgattattactccagtcttgagatta
gtgttttcactaacttccttggttgatacatctgactttttggaggttaagaataaaatt
gtccgtgaagtaatcgattttatcaaagggcatcaatcactgtttgatcaagttctccgt
ttagacattgccgaggcagatgaactaagaacagagcaggtcaatttagttgttggtatt
cttagcaaggtttggccatatgaagagagcaatgagtacggttttgttcaagggcttttt
ggtctgatgcatgctcttttctcacgtgattcaaagattcctagttttgctcaatcaaga
gtatcacctgagaatcagaggaattcagaactacagatgtttaatttgtgctacagcctg
agctcttacttgtattttctagtcacaaagaaatccctgagattacagccttcagatgcc
tcttccagttacgctgcttctgttgaacttcaacaacccacattgagcttgcttaattct
cttcttttttctgtcacaactgcttttgaaagggcagctgaggagaaatccttgttactg
aataagattcgagacataaatgaactgtcaaggcaggaagttgatgaaatcatcaatatg
tgtgtccggcaagactctgtttcatcttcagataacatacataaaaggaggtacattgca
atggtagaaatgtgtcgagttgttgctagtagggatcagctaatcattttattactgcca
ctctctgaacatgtgctaaatatcatccttatccatcttcaagagagctctgttgcactc
gattctaccttgagtacaaaaacaattgcatatggtgccaaatatgatgcacaacaggac
gttgctatgttatatggaaagttagttccaacccttgagcgacttgagttgctgagtgag
gagaaagtagggcacaatctcaaagtattccgcagattagcaacttctgccaaagatctt
gcaattcaaaaattgattgtgtag

DBGET integrated database retrieval system