KEGG   Glycine max (soybean): 100777843Help
Entry
100777843         CDS       T01710                                 

Definition
(RefSeq) general transcription factor IIH subunit 4-like
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
gmx  Glycine max (soybean)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100777843
  Replication and repair
   03420 Nucleotide excision repair
    100777843
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100777843
DNA repair and recombination proteins [BR:gmx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100777843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 451 aa AA seqDB search
MPEVRIIAKNFMDMVASMPAMKLDKLYENGFICEAILRSVPPLAKKYVIQMLHIDVPVAA
KLLEEWVLPAGVSKHRVAIDRLVQLRVFLEAVDRKNEKTYKVNPTFQRSLQKLLVQGGTL
PRESMPSNITVRLPTLENLEAYALEQWECFLLQLISPSQVEKPLNISSSLMKVFQRRILS
HRDKEAPKLTESGFQFLLMDTNAQLWYIIREYISNSEDRGVDAADLISFMLELSFHVIGE
AYSVDTLTSFQRTIINDLADLGLVKIQQGRKGSWFIPTKLATNLSMSLADSSSRKQGFVV
VETNFRVYAYSTSKLHCEILRLFSRVEYQLPNLIVGAITKESLYSAYENGITAEQIVTFL
QQNAHPRVAERVPSVPENVTEQIRLWEADLNRVEMTDTYYYDEFPSRDVFEGACDCAREW
NGLLWEDSKKMHMVVKTEVHPYVRDYLRRQK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaggatcattgccaagaatttcatggacatggtggcttccatgcctgcc
atgaagctcgataagctctatgaaaacggattcatctgtgaagctattctcaggtctgtt
ccacctcttgcgaagaaatatgtcatacagatgctgcatattgatgtgccagtggcagct
aaattgttggaggaatgggtgcttccggctggagtttcaaagcacagagtggccattgat
aggttggttcaattgagagttttccttgaagctgttgacaggaagaatgaaaagacttac
aaagttaatccaacatttcagagaagtctccaaaaacttttagtacaaggtggaactttg
ccaagggaatcaatgccttctaatattactgtaaggctcccaacattagagaatcttgag
gcttatgctctagaacaatgggagtgtttcttattgcaacttataagcccaagtcaggtt
gaaaagcccttaaatattagctcttccttgatgaaggttttccagcggcgtatcctgagt
cacagagacaaagaagctccaaaattaactgaaagtggtttccagtttttgctgatggat
acaaatgcacagctttggtacatcatcagggaatatatctctaattctgaggatagaggt
gttgatgcagctgatttgatctcattcatgctggaacttagttttcatgtcattggggag
gcttatagtgttgacacattgactagttttcagaggaccataattaatgacctagcagac
cttggattggtaaaaattcagcagggcaggaaagggagttggtttatacctactaaattg
gcgaccaatctttcaatgagcttggctgattcatcatctagaaaacagggatttgtggtt
gtggaaacaaattttagagtttatgcttactcaacttctaaattacattgtgagatattg
cggctattctcaagggtagagtatcaacttccaaatcttattgttggggctattacgaaa
gaaagcttatatagtgcttatgaaaatggcattacagcagagcagatagtcactttcctt
cagcaaaatgctcatcctcgtgttgcagagagggtaccatctgtgcctgaaaatgtcaca
gaacagattaggctgtgggaagcagatctaaacagagttgagatgacagacacatattat
tacgatgagttcccttccagagatgtgtttgaaggagcatgtgactgtgctagagaatgg
aatggtttgttgtgggaagattcaaagaagatgcatatggttgttaagaccgaggtacat
ccgtatgtacgagattatttacgccgtcaaaagtaa

DBGET integrated database retrieval system