KEGG   Glycine max (soybean): 100777843Help
Entry
100777843         CDS       T01710                                 

Definition
(RefSeq) general transcription factor IIH subunit 4-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 451 aa AA seqDB search
MPEVRIIAKNFMDMVASMPAMKLDKLYENGFICEAILRSVPPLAKKYVIQMLHIDVPVAA
KLLEEWVLPAGVSKHRVAIDRLVQLRVFLEAVDRKNEKTYKVNPTFQRSLQKLLVQGGTL
PRESMPSNITVRLPTLENLEAYALEQWECFLLQLISPSQVEKPLNISSSLMKVFQRRILS
HRDKEAPKLTESGFQFLLMDTNAQLWYIIREYISNSEDRGVDAADLISFMLELSFHVIGE
AYSVDTLTSFQRTIINDLADLGLVKIQQGRKGSWFIPTKLATNLSMSLADSSSRKQGFVV
VETNFRVYAYSTSKLHCEILRLFSRVEYQLPNLIVGAITKESLYSAYENGITAEQIVTFL
QQNAHPRVAERVPSVPENVTEQIRLWEADLNRVEMTDTYYYDEFPSRDVFEGACDCAREW
NGLLWEDSKKMHMVVKTEVHPYVRDYLRRQK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaggatcattgccaagaatttcatggacatggtggcttccatgcctgcc
atgaagctcgataagctctatgaaaacggattcatctgtgaagctattctcaggtctgtt
ccacctcttgcgaagaaatatgtcatacagatgctgcatattgatgtgccagtggcagct
aaattgttggaggaatgggtgcttccggctggagtttcaaagcacagagtggccattgat
aggttggttcaattgagagttttccttgaagctgttgacaggaagaatgaaaagacttac
aaagttaatccaacatttcagagaagtctccaaaaacttttagtacaaggtggaactttg
ccaagggaatcaatgccttctaatattactgtaaggctcccaacattagagaatcttgag
gcttatgctctagaacaatgggagtgtttcttattgcaacttataagcccaagtcaggtt
gaaaagcccttaaatattagctcttccttgatgaaggttttccagcggcgtatcctgagt
cacagagacaaagaagctccaaaattaactgaaagtggtttccagtttttgctgatggat
acaaatgcacagctttggtacatcatcagggaatatatctctaattctgaggatagaggt
gttgatgcagctgatttgatctcattcatgctggaacttagttttcatgtcattggggag
gcttatagtgttgacacattgactagttttcagaggaccataattaatgacctagcagac
cttggattggtaaaaattcagcagggcaggaaagggagttggtttatacctactaaattg
gcgaccaatctttcaatgagcttggctgattcatcatctagaaaacagggatttgtggtt
gtggaaacaaattttagagtttatgcttactcaacttctaaattacattgtgagatattg
cggctattctcaagggtagagtatcaacttccaaatcttattgttggggctattacgaaa
gaaagcttatatagtgcttatgaaaatggcattacagcagagcagatagtcactttcctt
cagcaaaatgctcatcctcgtgttgcagagagggtaccatctgtgcctgaaaatgtcaca
gaacagattaggctgtgggaagcagatctaaacagagttgagatgacagacacatattat
tacgatgagttcccttccagagatgtgtttgaaggagcatgtgactgtgctagagaatgg
aatggtttgttgtgggaagattcaaagaagatgcatatggttgttaagaccgaggtacat
ccgtatgtacgagattatttacgccgtcaaaagtaa

DBGET integrated database retrieval system