KEGG   Glycine max (soybean): 100778218Help
Entry
100778218         CDS       T01710                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100778218
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100778218
   00020 Citrate cycle (TCA cycle)
    100778218
   00620 Pyruvate metabolism
    100778218
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100778218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 547 aa AA seqDB search
MASHLLNHSSKMRNASKLLHHERALLVRWFSGDAHSSLNRNRDVWKTQFHESSARSSVFE
PASCFNKHSFGMQKRNIFMATIKRGSIIGSEFNGEISRSLQVLSRRCYASASDLPPHQEI
GMPSLSPTMTEGNIARWLKKEGDRISPGEVLCEVETDKATVEMECMEEGFLAKIIRGDGA
KEIKVGEVIAVTVEDEGDIAKFKDYQPSASEPSEPPAKETSAPPPPKKEEVVEEPAREPE
PKVSKPSAPPSSGDRTFASPLARKLAEEKNVPLSSIKGTGPEGLIVKADIDDYLASGAKE
VSASSKAKVAADAALDYTDIPVSQIRKVTASRLLLSKQTIPHYYLTVDTCVDKLMSLRTQ
LNSLQEASGGSRISVNDLVIKAAALALRKVPQCNSSWANDYIRQYHNVNINVAVQTDNGL
FVPVVRDADKKGLSKIGEEVKQLAKKAKENSLKPQEYEGGTFTVTNLGGPFGVKQFCAII
NPPQAGILAVGSAERRVVPGSGAEEFKFASFMSVTLSCDHRVIDGAIGAEWLKAFKGYIE
NPETMLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcatttactcaatcactcctccaagatgagaaatgcttccaagttgctgcac
cacgagcgcgctcttttggttcgttggttttccggcgatgctcattcatccctcaaccgg
aaccgcgatgtgtggaaaactcaattccacgagtcttcagcaagaagcagtgtctttgaa
ccagcctcctgctttaataaacattcatttggcatgcagaagagaaacatcttcatggct
accattaaaaggggttccattatcgggtctgagttcaatggagagatttcacgaagtttg
caggtactgtcgaggagatgctatgcgtcagcctcagatctccccccacaccaggaaatt
ggaatgccttctctctcacctacaatgacagagggtaacattgcaagatggttgaagaaa
gaaggtgatagaatctctcctggtgaagtgctctgtgaagttgaaactgataaagccact
gttgaaatggaatgtatggaggaaggttttctggccaagataatccgtggggatggggca
aaagaaattaaagttggtgaggtaattgccgtaactgttgaagatgaaggggatattgca
aaattcaaagattaccaaccttcagcatctgaaccaagtgaaccccctgccaaagaaaca
tctgccccacctccaccaaagaaagaagaggtggtagaggagcctgcccgagaacctgag
ccaaaggtttctaaacccagtgcaccaccttcatctggagatcgcacatttgctagtccc
cttgctcgaaaattggctgaagagaaaaatgtacctctctctagcattaaaggaacagga
cctgaagggctcattgtcaaggccgacattgatgattacttggcttctggtgctaaagaa
gtttcggcatcctccaaggccaaggttgcagcagatgcagcattggattataccgacatt
cctgtctctcagatacggaaggtcacagcttcacggttattattatcaaaacaaactatc
cctcattactatttaacagtagatacatgcgttgataaactcatgagcttgcggacccaa
ctcaattcattgcaagaagcctctggtggctctcgcatatcagttaatgaccttgtaatc
aaggctgctgctttggctctccgtaaagttcctcaatgtaacagttcatgggcaaatgat
tatattcgccagtatcataatgtgaatattaatgttgctgtgcagacagataatgggctc
tttgttccagttgtcagggatgcagacaagaaaggcctctctaaaataggggaagaggtc
aaacaattggcaaagaaagccaaagaaaacagcttgaaaccccaagaatatgagggaggt
acatttacagtgactaacctgggagggccatttggtgtcaaacaattctgtgcaatcatc
aatcctcctcaggcaggcattcttgccgttggatctgctgagaggagggtcgttccgggt
tcgggtgctgaagaattcaagtttgcttccttcatgtctgtgaccctcagctgtgatcat
cgtgttatagatggtgcaattggtgccgaatggttaaaagcattcaaaggctatattgaa
aatccagagaccatgttgttgtaa

DBGET integrated database retrieval system