KEGG   Glycine max (soybean): 100778423Help
Entry
100778423         CDS       T01710                                 

Definition
arginase 1, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gmx  Glycine max (soybean)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmx01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gmx00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 338 aa AA seqDB search
MSIITRRGIRYMPRLDAAKVSAALLEKGQNRVIDASLTLIRERAKLKGELVRALGGAKAT
STLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKELQDARVLTDVGDVPIQE
IRDCGVDDHRLMNVIGESVKLVMEEDPLCPLVLGGDHSISFPVIRAVSEKLGGPVDVLHL
DAHPDNYDAFEGNIYSHASSFARVMEGDYVRRLLQVGIRSITAEGRAQAKKFGVEQYEMR
TFSRDRPFLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQG
AVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattataacacgcagaggcatccgttacatgccaagactagatgcagcaaaagta
tctgctgctttgctagaaaaaggccaaaatcgtgtcatagatgcttcacttacacttatt
cgagaaagagcaaagcttaagggagaacttgtgcgtgctttgggaggtgctaaagcaact
tcaactcttcttggagttcctttgggacataattcatcgttccttcaagggcctgcattt
gcacctcctcgcattagggaggccatttggtgtggtagcaccaactcaacaactgaagaa
ggcaaggaattacaagatgcacgagtgctaactgatgttggtgatgttcctatccaggaa
attcgagattgtggggtagatgatcacagattaatgaatgtaattggtgaatctgtaaag
ttagtgatggaggaggatccattatgtcccttagttttaggcggtgatcactcaatatca
tttccagttatcagagctgtctctgagaagcttggaggaccagttgatgttcttcatctt
gatgcgcatcctgataactatgatgcctttgaaggaaacatttattcacatgcttcttct
tttgctcgagtcatggagggtgactatgttcgacgtctcttgcaggttggtattagatca
ataacagctgaagggcgtgcacaagccaaaaaatttggtgttgagcaatatgaaatgcga
acattttcaagggatcgcccctttctagagaacctgaaactaggggaaggtgttaaaggt
gtatatatctcaatagatgtggattgtctcgatcccgcctttgctccaggagtgtctcac
atagagccaggaggtctttctttccgtgatgttctcaacatcctgcacaatcttcaaggc
gctgttgttgctggagacgtggtcgaatttaacccgcaacgtgataccgttgatggaatg
actgccatggtagctgctaagctggtcagagaactggctgcaaagatttctaaatga

DBGET integrated database retrieval system