KEGG   Glycine max (soybean): 100779074Help
Entry
100779074         CDS       T01710                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic-like
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gmx  Glycine max (soybean)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:gmx00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 396 aa AA seqDB search
MASSLFLCSNYVFPTSQNPFRSNHLAQFRPNGPSNFHSKLRFQRPHLVRAMVSDSNTSRR
QIEIVYDPEGRINKLADEVDRETPLSRLTLFSPCKINVFLRITNKREDGYHDLASLFHVI
SLGDIIKFSLSPSKTKDSLSTNVSGVPLDDRNLIIKALNLYRKKTGSDKYFWIHLDKRVP
TGAGLGGGSSNAATTLWAANQFSGCPASEKELQEWSSEIGSDIPFFFSQGAAYCTGRGEV
VQNIPPPVSLDVPMVLIKPPEACSTAEVYKRLCLDQTSNVEPLTLLEKISKIGISQDVCI
NDLEPPAFEVLPSLKRLKQRISAAGRGEYDAVFMSGSGSTIVGVGSPDPPQFVYDDDEYK
DVFLSDAYFLTREENQWYQEPTSSPSASPSVVSESV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctctctttctttgcagtaactacgtcttccccacttcccaaaaccccttc
agaagcaaccatttagctcaattcagaccaaatgggccctccaattttcactcaaagctt
cggtttcagagaccccacttggtcagagccatggtttctgattccaacacttccaggaga
caaatagagattgtgtatgaccccgaaggaaggattaacaagttggctgatgaagtggac
agggaaactcccctttcaaggcttactttgttctctccttgcaagataaatgttttcttg
agaataaccaacaagagggaagatgggtatcatgatttggcatccctttttcatgtgata
agtctaggtgacataattaagttctctttgtcaccttcaaaaaccaaggatagcctgtca
accaacgtgtctggggtgccccttgatgatagaaatttgattattaaggcgcttaatctt
tacaggaagaagactggcagtgacaagtacttttggattcatcttgataaacgggtgcct
actggggcagggcttggcggtggaagtagcaacgctgcaactacactatgggcagccaat
caatttagtggctgtcctgcctctgagaaagaactccaagaatggtcaagtgagattgga
tcagatattcccttctttttctctcagggagcagcctattgcactggtcgaggagaggtt
gttcagaatattcctccaccagtatctctagatgttccaatggttctcataaagccccca
gaagcatgttcaactgccgaagtctacaagcgtctatgtttggaccagactagtaatgtt
gaacctttaacattgctggagaagatctcaaagattggcatctcacaagatgtttgtatt
aatgatttagaacctccagcatttgaagttctcccctctctcaaaagactgaagcagcga
attagtgcagctggtcgtggagaatatgatgctgtttttatgtcaggaagcggaagcacc
attgttggagttggttctcctgatcctccacaatttgtttatgatgatgacgaatacaaa
gatgtgttcttatcagatgcctattttctcactcgagaggaaaatcagtggtaccaagag
cctacttcaagtccttctgcctcaccttcagttgtttctgagtctgtttga

DBGET integrated database retrieval system