KEGG   Glycine max (soybean): 100779469Help
Entry
100779469         CDS       T01710                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK2
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 373 aa AA seqDB search
MSAVESAEHNNIRGVPTHGGRYVQYNIYGNLFEVSRKYVPPIRPVGRGAYGIVCAAVNAE
TGEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHANIMSIKDIIRPPQKENFNDVYLVS
ELMDTDLHQIIRSNQQLTDDHCRYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK
IADFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIITRQPLF
PGKDYVHQLRLITELIGSPDDASLGFLRSDNARRYVKQLPQYPKQNFSARFPTMSPGAVD
LLEKMLIFDPNRRITVDEALSHPYMSPLHDINEEPVCTRPFSFDFEQPSFTEEDIKELIW
RESVKFNPVPPVY
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgttgagtcagctgaacacaacaacatcagaggagtaccaactcatggtgga
cgctatgttcagtacaatatctatggcaatctcttcgaagtttccagaaagtatgtccct
cctattcgccctgtcggtagaggtgcttatggtattgtttgcgctgctgtaaatgcagag
acaggcgaggaagttgccattaagaagattggcaatgcattcgacaacagaatagatgcc
aaaaggaccttacgggaaattaaacttcttcggcacatggatcatgcaaatattatgtcc
attaaagatattatacgtcctccacagaaggaaaacttcaatgatgtgtaccttgtttct
gagttaatggacacagatctgcatcaaataattcgttccaatcagcaattgactgatgat
cattgtcggtattttctgtatcaattgttacgagggctcaaatatgtacattcagcaaat
gttttgcaccgagatctaaagcctagtaatttgctattgaatgccaattgtgaccttaag
attgcggactttggtcttgctagaaccacatctgaaactgactttatgactgagtatgtg
gtcactagatggtaccgagctcccgaattgcttcttaattgttcagaatatacagcagcc
attgatatatggtctgttggttgcatacttggtgaaatcataacaagacaaccgctcttt
cctggcaaagattatgttcatcagctgagacttatcacagagctgataggttcgccagat
gatgccagccttggatttctacgaagtgataatgctcgtagatacgtaaaacagcttccg
cagtatccaaaacaaaacttttctgctagatttcccaccatgtctcctggtgcggttgac
ttgctagagaagatgctcatctttgatccaaacaggcgtattacagttgacgaggcgttg
agccacccatacatgtcacctctccatgacatcaatgaggaacctgtttgcaccagacct
ttcagttttgactttgagcaaccatcattcactgaagaagacatcaaggaactcatctgg
agagaatctgtgaagttcaatcctgttccaccagtctactga

DBGET integrated database retrieval system