KEGG   Glycine max (soybean): 100779711Help
Entry
100779711         CDS       T01710                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100779711
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100779711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 718 aa AA seqDB search
MADVMIMKEIEDTSLRLGVDLSTLDLDAIRLPTGEDCGIVSDDEEVYQEENLEFESGFGN
IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETEKTLGYCFIEYNTPQ
EAELAKEKTHGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYAPGENLQHWLTDAK
ARDQFVIRAGSDTEVLWNDARHLKPDPVYKRAFWTESFVQWSPLGTYLATVHRQGAAVWG
GAGSFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINLFDVRTGKVMRD
FKGSADDFAVGGAGGVTGVSWPVFKWSGGRDDKYFARMGKNILSVYETETFSLVDKKSLK
VENIMDFCWSPTDPIIALFVPEMGGGNQPARVSLIQIPSKVELRQKNLFSVSDCKMYWQS
NGDYLAVNVERYTKTKKSTYTGFELFRIKERDIPIEVLELENKNDKIIAFAWEPKGHRFA
VIHGDNPKPDVSIYSMRTGQNSRVSKLTTLKGKQANALFWSPAGRYIVLAGLKGFNGQLE
FYNVDELETMATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKD
HFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEW
DKWVNEWKRIHEEESLQRQKLRDGEASDEEEEYEAKDIEVEEVIDLTEEVLHLEYGQE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtcatgattatgaaggagatcgaggacacgtcgcttcgtctcggcgtcgat
ctctccactctcgatctcgacgccattcgcctccctaccggcgaagattgcggcatcgtc
agtgatgacgaggaggtttaccaggaggagaatctcgagtttgagtctggatttggtaac
atcattgtcgtggataacctccctgtcgttccgagggagaagttcgagaagctcgaagga
gtggttcgcaaaatttatagtcaaattggtgttatcaaggaggatggcctctggatgccg
gttgatcctgaaaccgagaaaaccctaggttactgcttcattgagtacaatacccctcag
gaagctgaacttgctaaagagaagactcatgggtacaaattggaccgtgcacacatattt
gccgtgagcatgtttgatgactttgacagattcatgaaggtgcctaatgagtgggctcct
cccgaaactaagccatatgctccaggggaaaatcttcaacactggctcactgatgcaaag
gccagggatcagtttgtgattcgtgctggttcagatactgaagttttgtggaacgatgcc
aggcatttaaagcctgatcctgtttataagcgtgcattttggacagagagttttgtgcaa
tggtctcctttggggacatatttggcaactgttcacagacagggagcagcagtctgggga
ggtgctggaagctttaatagacttatgcgttatgcgcatcctcaggtaaaactaattgat
ttttcgcctggtgagaagtatttggtaacatatagcagtcatgaaccaagcaatccccga
gatgccaatagagttgtgataaatttatttgatgtgaggactggtaaagtgatgagggac
tttaaaggaagtgctgatgattttgcagtcggaggtgctgggggtgtcactggagtttca
tggcctgttttcaaatggagtggtggaagagatgataaatactttgcaaggatggggaaa
aatatactctccgtttatgagacagagaccttttctctcgttgacaagaaatctttgaag
gttgaaaatataatggatttctgctggtctccaactgatccaattattgctctttttgtt
cctgagatgggaggtggtaaccagcctgccagggttagtctgattcaaatccccagcaaa
gtggaactcaggcagaaaaaccttttcagtgtcagtgactgcaagatgtactggcaaagc
aatggagactaccttgctgttaatgtagagaggtacacgaaaacgaaaaaaagcacatac
acaggctttgagcttttccgtataaaggaacgggatataccaattgaagttttggagctt
gagaataagaatgataagatcattgcatttgcttgggagccaaagggccacaggtttgca
gttattcatggtgataaccctaagcctgatgttagcatttactccatgcgtactggtcag
aacagccgagtttcaaaactcactactctgaagggcaagcaagcaaatgctctgttttgg
tcacctgctggtcgctacattgtactggctgggttgaaaggcttcaatggacagttggaa
ttttacaacgttgatgaacttgaaaccatggctactgctgaacattttatggcaacagat
attgaatgggatccaactggaagatatgttgcaactgcagtgacttcagttcatgaaatg
gagaatggtttcaatatatggtctttcaatggcaagcatctatatcggattctgaaggat
catttctttcagttcttatggagaccaaggccaccatctttcttgactcccgagaaagag
gaagagattgccaagaacttgaagaagtacagtaagaaatacgaggcagaagatcaagat
gtttcgttgctgctgagtgaacaagagcgggagaagcgcaggatgttgaaagaagagtgg
gacaagtgggttaacgaatggaagcggatccacgaggaagagagtttacagaggcaaaag
ctcagggatggagaggctagcgatgaagaggaggaatacgaggcaaaggacatcgaggtg
gaggaagtgatcgatcttacagaagaggtccttcaccttgagtatggtcaagagtga

DBGET integrated database retrieval system