KEGG   Glycine max (soybean): 100780144Help
Entry
100780144         CDS       T01710                                 

Definition
probable serine/threonine-protein kinase mps1-like
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100780144
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100780144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 755 aa AA seqDB search
MDGKPNPYSSSTDLLRDVQAALKRHRPLGSMQSNCIRPRRTLLPQRRASSTSSSSSDVTN
SQEEASSKDSLNAVVPSQNLDSQKKVQFSVPSNAASQDGKATELENLSSHMSSLGFAEME
WVEGSQIEAWSSSSSLGCNQQESVQQAGIDASLKCESGVSSVLPKRSVVTPDHLQQFRSF
LSQPATQSSVVGPTCATTTSVHSTSAPMLNSTTRYSHFRQYCGSSVAAEPLGEVNVNPCP
ITEGVVKSIDVSIQETNRMPVDPGAEAEVRASGSCIDDAGSLSKESNQSKEQQGGELKES
GNSKYTSCDDGKGKEAVDVATVQMQAPLPTTITSSSDVKLGSSKVEKREKAASSKGTLGA
RKRTYDPDLFFKVNGKLYQRLGKIGSGGSSEVHKVISSDCRIYALKKIKLKGRDYATAYG
FCQEIEYLNRLKGKDNIIQLIDYEVTDKALLEEVMKGSFSNKDGRVKDDGCIYMVLEYGE
IDLAHMLSQKWKELDGSYQTIDENWLRFYWQQILLAVNTIHEDRIVHSDLKPANFLLVKG
SLKLIDFGIAKAIMSDTTNIQRDSQVGTLSYMSPEAFLCNETDANGNIIKCGRPSDIWSL
GCILYQMVYGRTPFSDYKTFWAKFKVITDPNHKITYEPVSNPWLLDLMERCLAWDRNQRW
RIPQLLQHPFLVPPVPSHPCLPQDHSCKLLQLISETCTYDPEASQLCSRLQRLLSDPLEK
TTRSLNSGDQQLKLLSQMSELCIQLHERLTNTEYK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaagcctaacccgtattcctcctccacggacctcctccgcgacgttcaagcc
gccttgaaacgacaccgtcctctcggttcaatgcagtccaattgcataagaccaaggcgc
acgctacttcctcaaagaagagcatctagcacttcttcttcttcttccgatgtcaccaat
tctcaagaagaagcttcttccaaggattcgctcaacgccgtcgtcccttctcaaaaccta
gactctcagaagaaagtccagttttcagttccaagcaacgctgcctcgcaggatggaaag
gccactgagttggagaatttatcttctcacatgagttcgcttggattcgcagaaatggag
tgggttgaaggcagccaaatcgaagcatggtcgtcgtcgtcgtcgcttggatgcaaccag
caggagagtgttcagcaggcggggattgacgcgagtttgaaatgcgagagtggagtgagt
tccgtgctgccgaagagaagcgtggttactccggatcatttgcagcaattcagaagtttt
ttgagtcagccagcgacgcaatcttcggtggtcggacctacttgtgccacaactacatct
gttcattcaacttcagcgccaatgctgaattcaacaacacggtattctcatttccgtcaa
tattgtggctcaagtgtggctgctgagcctttgggggaggttaatgttaatccatgccct
ataactgaaggggttgtgaaatcgattgatgtttccatacaagaaaccaatagaatgcca
gttgatccgggggcagaagctgaagtccgagcttctggttcttgtattgatgatgcaggg
tcgttatccaaggagagcaatcaatctaaggagcaacaagggggtgagttgaaagaatct
ggcaattctaagtatacttcttgtgatgatgggaaagggaaagaggctgtggatgttgcc
actgtacaaatgcaggctccacttcccacaaccataacctcatcttcagatgtgaagttg
gggtcttctaaggtagaaaaacgagagaaggctgcaagtagtaaaggtacattgggtgcc
cggaaaagaacttatgaccctgatttgtttttcaaagtcaacggcaagctttatcagcga
cttggcaagataggtagtggtggaagcagtgaggtgcacaaggtgatttcatcggactgt
aggatatatgcacttaaaaagatcaagctcaagggtcgtgattatgctactgcatatggg
ttttgtcaagagattgagtatctaaataggctgaagggaaaggataacatcatacagctt
atagattatgaggtgactgacaaggctttgcttgaggaagttatgaaaggctccttcagt
aataaagatggccgggtcaaggatgatggatgtatatacatggtgcttgaatatggggaa
attgatttggctcacatgttgtctcagaagtggaaggaactggatggaagctaccaaact
atagatgaaaactggcttcgattttattggcagcaaattcttttagctgtcaacactatt
catgaggaccggattgtgcactcagacttgaagccggctaacttcctccttgtcaaaggc
tccctaaaactgattgattttggtatagccaaagcaataatgagtgacacaaccaacatc
caacgggattcacaggtgggcactctaagctacatgtctccagaagcatttttgtgtaat
gaaactgatgcgaatggaaacatcataaagtgtgggcgaccatcagatatctggtccctg
ggttgcatcctttatcaaatggtatatggcaggacacctttttctgattacaagacattt
tgggccaaattcaaagttataacagatccaaatcataaaattacgtatgaaccagtttca
aacccatggcttttggatcttatggaaaggtgtctagcatgggatcgcaatcaaaggtgg
agaattcctcagctactccaacatccttttcttgttcctcctgtaccatctcatccatgt
ttgccccaagatcatagctgtaaattgctacaacttatttctgaaacttgtacatatgac
cctgaagcatcccaactgtgtagtcgcctccaacggcttcttagcgacccacttgagaaa
acaactcgctcactaaattcaggagatcaacaactaaaactgctgtcccaaatgtcagaa
ctctgtattcagctgcacgaacgtttgacaaatactgaatacaagtag

DBGET integrated database retrieval system