KEGG   Glycine max (soybean): 100780250Help
Entry
100780250         CDS       T01710                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100780250
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100780250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 520 aa AA seqDB search
MTRVLVQRGSSGGGSTSSNPNRSGGGSSSNSSARAEPQVPVLPENSDEVVVGVVSDEVLE
SGDKGKSDESVHFEQGDGSCDDGVAAAVVVESDVREEIVKGLSGLRVGERVVSESEVSSG
DSSSLLVGGGGSCPPPPPVPPPKPSVTGNLNPRRSVSGSLNSGIVGSSRRAWPVVSARTS
PAGSRPSSPRSHNESEGYNSADEQKPCLVSSYDDFERERQFEIDIRRAKGYEVKKMMEDG
NCLFRAVADQVYGDSEVYDLVRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNN
VEIQAMCEMYNRPIHIYSYTTEPINIFHGSYNTDTPPIRLSYHHGNHYNSLVDPRRLTIG
AGLGFSSLRGTNVDKDKVKAAIKAQQDQQINNALLAEGRFYSDLELTEKEIERMVIEVSR
AEYLADSAFKQQLGNRESSTSNAEPSSSGATGSSGTDRKTEHGREHGSDLSSGMQMLLSM
GFSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRRKGKATE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgttttggttcagaggggttcttccggtggtggttcgacttcgtccaacccg
aaccggagtggtggtgggtcttcttctaattcctcggcgcgggcggagccgcaggttccg
gttttgccggagaatagcgacgaggttgttgttggtgttgtgtcggatgaggttttagag
agtggtgataagggaaaaagtgacgagagtgttcattttgagcagggtgatggatcgtgt
gacgatggcgtggctgctgctgttgttgttgagagtgatgttagggaggagattgtgaag
gggttgagtgggcttagagttggtgaaagggttgtttcggagagtgaggtttcgagtggg
gattcttcttccctccttgttggtggtggtggttcgtgtcccccgccgcctcctgtgccg
cctcccaagccttccgtgacggggaacttgaatccgaggaggagtgtgtccgggagtttg
aattccggcattgtgggatcctcgaggagggcgtggccggttgtttcggctaggacttcg
cctgctgggtctaggccgtcttctcccaggtcacataatgaaagtgaggggtacaacagt
gctgatgagcagaagccttgcctggtttcatcttatgatgattttgaaagggagcggcag
tttgaaattgatatcagaagggcaaaaggttatgaagtcaaaaaaatgatggaggatgga
aattgtcttttccgagctgttgcagatcaggtgtatggggactctgaagtgtatgatttg
gtcagacagatgtgcatagattatatggagcgagagagagatcacttttctcagtttata
actgaaggcttcacatcttactgcaagagaaaaagaagagataaggtctatggaaacaat
gttgagatccaagccatgtgtgaaatgtataatcgtccaattcacatatactcctacacg
acagaacctatcaatatctttcatggaagttacaacactgacacgccaccaatacgattg
agttatcatcatgggaatcattacaactcccttgttgatccacggcgcttgacaattggt
gctgggcttgggttcagcagtcttcgtggaacaaatgttgacaaagataaagtcaaggct
gctattaaagctcaacaagaccaacagatcaataatgccctgttagccgagggtcggttt
tactctgatcttgagctcacagaaaaggaaattgaacgcatggtgatcgaagtttctcga
gctgagtaccttgcagatagtgcatttaagcaacagcttggcaatagagaatcctctacc
tcaaatgctgaaccatcatcttctggagcaacaggatcatcgggcactgatcgcaagacg
gaacatgggagagagcatggttctgatcttagtagcggtatgcagatgttactatcaatg
ggattcagttacatgcaagcgattgaggcttacagcatatttggggacgatgttgattca
atggtttgttacctgttagaaaccggcagtagcagcagacgtaaaggcaaggccactgaa
tga

DBGET integrated database retrieval system