KEGG   Glycine max (soybean): 100781191Help
Entry
100781191         CDS       T01710                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase-like protein-like
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100781191
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100781191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 DUF4131
Motif
Other DBs
NCBI-GeneID: 100781191
NCBI-ProteinID: NP_001242425
UniProt: C6THV7
Position
5
AA seq 323 aa AA seqDB search
MAAFLRRFARATPILFAAQSNSSHTNLRLPFTAIAAISGGVSFLYYHSSPNFAHSQEAEQ
VESKNIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRASLGQDAE
GKPKFVIRPYTPISDPQSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYTP
NMKKHIGMIAGGTGITPMLQVIEAILKNPDDKTQISLLYANVSPDDILLKQKLDILATSH
PNLKIFYTVDNPTKNWRGGAGYISKDIVVKGLPGPSDDTLILVCGPPGMMKAISGEKAKD
WTQGEVSGVLKEAGYTEQMVYKF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttcttgagaaggtttgcgagggccactccgatcctattcgctgcccaatcc
aattcctctcacaccaatctccgccttcccttcactgccatcgccgccatttccggcgga
gtctccttcctttactaccattcctctcccaacttcgctcattcacaagaagcagaacaa
gtggaaagtaaaaacatcgcactcgttccggataaatgggtcgagtttaagttgcaggac
actgccagggttagtcacaatacccagctattcaggttttcatttgatcccactcagaaa
ttgggtctggatattgcctcttgcatccttacaagggcttcattgggacaagatgctgaa
ggaaaaccaaaatttgttatacgcccgtacactcctatttcagatccacaatcaaaggga
tattttgatttgcttatcaaggtatatcctgaagggaaaatgagccagcattttgcaagc
ttaaaaccgggtgatgttgttgaagtgaaaggccccattgaaaagctcagatatactcct
aatatgaagaagcatattggcatgattgctggaggcacaggaattactcctatgcttcag
gtaattgaagctatattgaagaatcctgatgacaaaactcagatatctttactttatgct
aatgtctccccggatgacatactgcttaaacaaaagcttgacattctagcaacaagccac
ccaaacttaaagatattctacactgtagataatccaacaaaaaattggagaggaggtgcg
gggtacatatcaaaggatattgttgtgaaaggcttacccggccctagtgatgatactctt
atacttgtgtgtggaccccctggtatgatgaaagcaatatctggagaaaaggccaaggac
tggacacagggagaggtttctggcgtcctaaaagaggctggatacactgaacaaatggta
tacaaattctga

DBGET integrated database retrieval system