KEGG   Glycine max (soybean): 100781423Help
Entry
100781423         CDS       T01710                                 

Definition
beta-amylase 1, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100781423
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     100781423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 570 aa AA seqDB search
MALNMTHQIGTLAAATVPVPNSSAGESTAAMSAATLWKPPAVSLKCKVTRTEGGAEGLSP
PLSPCRSPVLRADLSAACQAFTAEVAAEEYIAGGKEKGEGKEGVPLFVMMPLDSVKTGNA
VNRKKAMNAAMAALKSAGVEGVMMDVWWGLVEREKPGEYNWGGYVELMEMAKKHGLKVQA
VMSFHQCGGNVGDSCTIPLPKWVVEEIDNDPDLAYTDQWGRRNYEYISLGCDTSPVLKGR
TPVQCYADFMRAFRDTFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWNFPGIGGFQC
YDKYMLSSLKAAAEAEGKPEWGSTGPTDAGHYNNWPEDTQFFRKEGGGWDGPYGEFFLTW
YSQMLLDHGDRILSSATSIFDNTGVKISVKVAGIHWHYGSRSHAPELTAGYYNTRFRDGY
IPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAQVPLAGENALPR
YDEYAHEQIIRASQLDVDGDSGGREMCAFTYLRMNPHLFEPNNWRKFVGFVKKMKEGKSA
HKCWEEVEREAEHFVHVTQPLVQEAAVLMH
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaatatgactcaccagatcgggaccctggctgctgcgacggtgccggtgccg
aattcgtctgccggagaatcaaccgcggcgatgagtgccgccactctgtggaagccgccg
gcggtgagtctgaagtgcaaggtcacgaggacggagggcggcgctgaggggctgtcgccg
ccgctgagcccgtgcaggtcgccggtgctacgggcggatctgtcggcagcgtgtcaggcg
ttcacggcggaggtggcggcggaggagtacattgccggagggaaggagaaaggagagggg
aaggagggagtgccgctgtttgtgatgatgccgttggacagcgtaaagacgggaaacgcg
gtgaaccggaagaaggcgatgaacgcggcgatggcggcgctgaagagtgcgggggtggag
ggggtaatgatggacgtgtggtggggtttggtggagagagagaagcctggggagtataat
tggggagggtacgttgaactcatggagatggcgaagaagcatggcctgaaggtgcaggcc
gttatgtcatttcaccaatgtggcggtaacgtcggagactcttgcactattcctttaccc
aaatgggttgtggaggagattgataatgaccccgatcttgcatatactgatcaatgggga
agaagaaactatgaatatatatcacttggatgtgatacttcgccagtgctcaagggccga
accccagttcaatgttatgctgatttcatgcgtgctttcagagacactttcaagcacctc
cttggtgacaccattgtggaaattcaagttgggatgggaccggcaggtgagctgcgttac
ccttcttacccagagcaaaatgggacatggaatttcccaggaattggtggtttccaatgc
tatgacaagtatatgttgagtagcttaaaagctgctgctgaagctgagggtaagcctgaa
tggggaagcacaggccctactgatgctggacactataacaactggccagaagacactcaa
tttttccgcaaagaaggtggaggctgggatggtccatatggtgagtttttcctcacctgg
tactctcagatgctgttggaccacggtgacaggattctctcatcagccacgtcaatcttt
gacaacactggagtgaagatctcagtgaaggttgctggcattcactggcactatggctca
aggtctcacgccccagaactcacagcagggtattacaacacccggttccgtgatggctac
atccccattgctcaaatgttggcacgccacggtgccatcttcaacttcacctgtattgag
atgcgcgatcacgagcagccacaagatgccctttgtgcacccgagaagcttgtgaagcaa
gtggctctggcaacgcagaaggcacaggttccacttgctggtgaaaatgcgctgccacgg
tacgatgagtatgctcatgagcagatcataagggcatcacagttggatgttgatggtgac
tctggtggaagagagatgtgtgcattcacttacctgagaatgaacccgcatttgtttgaa
ccaaataactggaggaagtttgtggggtttgtgaagaaaatgaaagaagggaagagtgca
cacaagtgttgggaagaggtggagagggaagctgagcattttgtgcatgttacacagcct
cttgtgcaagaagctgcagtgctgatgcactga

DBGET integrated database retrieval system