KEGG   Glycine max (soybean): 100781560Help
Entry
100781560         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 13-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100781560
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100781560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1118 aa AA seqDB search
MTVMMPAPIDQQEDEDVLVPDADLPENNHQPMEVVAQPENANTVESQPVEDPPSSRFTWR
IDNFSRLNTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYLDVADSASLPYGWSRYAQF
SLAVVNQMHNKYSVRKDTQHQFNARESDWGFTSFMPLGELYDPSRGYLVHDTLIVEAEVL
VRRIVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPTG
SIPLALQSLFYKLQYSDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGT
VVEGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVESLE
GDNKYHAEQYGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLD
REDGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSEQWYKFDDERVTKED
NKRALEEQYGGEEELPQTNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAA
HLRERLKKEQEEKEHKKKEKAEAHLYTIIKVARDEELKEQIGKDIYFDLVDHDKVRSFRV
QKQTSFNLFKEEVAKEYGIPVQFQRYWLWAKRQNHTYRPNRPLSHIEEAQSVGQLREVSN
KVHNAELKLFLEVEPGMDSCPIAPPDKTKDDILLFFKLYDPEKEELRYVGRLFVKCTGKP
LEILARLNEMAGYDPEEDIALYEEIKFEPNVMCEPIDKKVTFRTSQLEDGDIICFQKASS
MDIEENVRYPDVPSYLEYVHNRQVVHFRSLERPKEDDFFLEMSRLFTYDDVVERVAQQLG
LDDPSKIRLTPHNCYSQQPKPQPIKYRGVEHLSDMLVHYNQTSDILYYEVLDIPLPELQG
LKTLKVAFHHATKDEVVIHTIRLPKQSIVGDVLDDLKTKVELSDPEAELRLLEVFYHKIY
KVFPPNEKIENINDQYWTLRAEEIPEEEKNLGPHDRLIHVYHFNKDAAQNQMQIQNFGEP
FFLVIHEGETLDEIKVRIQKKLQVPDDEFCKWKFAFLSLGRPEYLQDSDVVSSRFQRRDV
YGAWEQYLGLEHTDNAPKRSYAVNQNRHTFEKPVKIYN
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgatgatgcccgctcccattgatcagcaagaggacgaggacgtgctcgtgccg
gacgcggatttgcctgagaacaatcaccaacccatggaagttgtagctcaacctgaaaat
gccaatactgtggagagtcagcccgttgaagatcctccgtcatctagatttacatggaga
attgataacttttcaaggctgaatacaaagaagctctattcggaaatatttgttgttggt
ggctataaatggcgtgtgcttattttcccaaaaggaaacaatgtggactatttgtccatg
tatttggatgttgctgattcagccagtttgccctatggttggagtagatatgcacagttt
agcttggcagttgttaatcaaatgcataataagtattctgtgagaaaagacacacagcac
cagtttaatgcacgtgaaagtgattggggtttcacatccttcatgcctcttggtgaattg
tatgatcctagtagagggtatcttgtgcatgatactcttatagtcgaagctgaggttctt
gttcgtaggattgttgattactggacttatgattcaaagaaggagactggctatgttggg
cttaagaaccaaggagctacgtgttatatgaattctctactccaaaccttgtatcatatt
ccttattttagaaaggctgtgtaccatatgccaacaactgagaatgatatgcccactggt
agcatccctttggccttgcaaagtttattctacaagcttcaatacagtgacaccagtgtt
gcaacaaaggagctgacaaagtcttttggatgggatacatatgattctttcatgcagcat
gatgttcaagaactaaatcgggttctttgtgaaaaacttgaagacaaaatgaagggaact
gttgttgagggaaccatacaaaaattatttgaagggcaccatatgaattacatagaatgc
atcaatgtagactacaaatcaactagaaaggagtcattttatgaccttcagcttgatgtt
aaaggttgtcgtgatgtttatgcttcctttgataagtatgtcgaagttgaaagtcttgag
ggggataacaaatatcatgctgaacagtatggtttgcaggatgctaagaaaggtgtccta
tttattgattttcctcctgtccttcaactccagctaaaaagatttgaatatgattttatg
cgggatactatggttaagattaatgaccgttatgagtttcccttacaacttgatcttgat
cgtgaggatgggaaatatctatcacctgatgctgataggagtgtccgcaatctttacaca
cttcacagtgttttggttcacagtggaggtgtgcatggtggacattattatgcttttatc
aggccaaccctctctgaacagtggtacaaatttgatgatgagagggtgacaaaagaagat
aataaaagagcattagaggagcagtatggtggtgaggaagagttaccacagacaaatccc
ggattcaataacaccccatttaagttcaccaaatactcaaatgcttatatgctggtgtat
atacgtgaaagtgacaaggacaaaatcatatgcaatgtggatgagaaagacattgcagca
catttaagggagaggttgaagaaagaacaagaagagaaagagcacaaaaagaaagaaaag
gcagaagctcacctttatactattataaaggtggcacgagatgaagaacttaaagagcag
attggaaaggatatatactttgatcttgtagaccatgacaaagtgaggagtttcagagtc
caaaagcagacatcttttaaccttttcaaggaagaggttgcaaaagagtatggtatacca
gttcaatttcagcgttattggctatgggcaaagcggcaaaaccatacttatcgtcctaat
agaccattgagtcacattgaggaagcacaatctgttggacaattgagagaagtgtccaac
aaggttcacaatgcagaactgaaattgtttttggaagtggaaccggggatggattcatgt
cccatcgcaccacctgacaagaccaaggatgatatattacttttcttcaagctatatgat
cctgaaaaagaggagctgcgttatgttggaaggctctttgtgaagtgtactggtaagcca
ttggaaatcttagcgaggttaaatgaaatggctggttatgaccctgaagaagatattgca
ctatatgaggaaattaagtttgaaccaaatgtcatgtgtgaacctattgacaagaaagta
acatttcgaacaagccagctggaagatggagatatcatttgctttcagaaggcttcctct
atggatattgaggaaaatgtccggtatccagacgtgccctcatatttagaatatgtgcac
aatcgccaggtggttcactttcgatctctggagagaccgaaggaagatgactttttcttg
gagatgtcaaggctttttacatatgatgatgtggtggagagagtagcccaacaacttggt
ttggatgatccgtccaaaatacggcttacaccacacaactgctactctcaacaaccaaaa
ccccagcctatcaaataccgaggggtagaacatttgtctgatatgttagttcattacaat
cagacatcggatatactatactatgaagtacttgacatccctctaccagaattacaaggg
ttgaaaactctgaaagtcgcatttcatcatgccactaaggatgaagtggttattcatact
attcgactcccaaagcagagcattgttggggatgtccttgatgatcttaaaacaaaggta
gagttatctgatcctgaagctgaacttcggttgcttgaagtcttctatcacaaaatatac
aaggtcttccctcccaatgaaaagattgaaaacattaatgatcaatactggacattacga
gcagaggagattccagaagaagagaaaaatcttggtcctcatgatcgtctaattcatgtg
taccatttcaataaagacgcggctcaaaaccaaatgcaaattcaaaactttggggaacct
ttttttcttgttatacatgaaggtgaaactctagacgaaattaaagtgcgaatacaaaag
aaacttcaagttcctgatgatgaattttgcaagtggaaatttgcatttctatcactgggc
cgtcctgagtaccttcaagattctgacgttgtatccagtcgttttcagagaagagatgtt
tatggtgcttgggagcaatatcttggcttggagcatactgacaatgctcctaaaagatca
tatgctgtcaaccagaatcgccacacatttgagaagccagtaaagatttataattag

DBGET integrated database retrieval system