KEGG   Glycine max (soybean): 100781892Help
Entry
100781892         CDS       T01710                                 

Definition
eukaryotic translation initiation factor 4E-2-like
Orthology
K03259  
translation initiation factor 4E
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100781892
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100781892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 200 aa AA seqDB search
MATSEEVVAAAPEAAALEAGLKHKLERKWTFWCDNQSKPKQGAAWGTSLRKVYTFDTVEE
FWCLYDQVFKPSKLQINADFHLFKTGIEPKWEDPECANGGKWSVTSNSGRKANLDNMWLE
TMMALIGEQFEDAEDICGVVASVRQWQDKLSLWTKTAANEAAQMSIGRKWKEIIDVNDKI
TYNFHDDSRTKGASKGRYTV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagcgaagaagtggttgcggcggcgccggaggcagccgcgctggaggcaggg
ctgaagcacaaactggagagaaaatggacgttttggtgcgacaaccaatccaaacccaaa
cagggcgctgcttggggtacctctcttcgcaaggtctacaccttcgacaccgttgaagag
ttctggtgtttgtatgatcaggtattcaagcccagcaagttgcaaatcaatgcggatttt
cacttgttcaagactgggattgagcctaaatgggaagatcctgagtgtgccaatggagga
aagtggtcagtcaccagcaacagcggcaggaaggctaaccttgataacatgtggcttgaa
actatgatggctttgattggggagcaatttgaggatgccgaggacatatgtggtgttgtt
gcgagtgtgcgccagtggcaggacaaactttcgttgtggacaaagacagcggcaaatgag
gctgcccagatgagcattggaaggaagtggaaggaaatcatagatgttaacgacaagata
acatacaactttcatgatgattctagaaccaaaggagcatcaaagggtcgatacaccgta
taa

DBGET integrated database retrieval system