KEGG   Glycine max (soybean): 100782415Help
Entry
100782415         CDS       T01710                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100782415
Enzymes [BR:gmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100782415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 317 aa AA seqDB search
MGHSAAVWDYRAATEITKDWNGIHQIVLRTPRGASAQVSLHGAQVTSWRNEHGEELLFTS
SKAIFKAPKAIRGGIPICFPQFGNCGSLELHGFVRNRMWAIDDNPPPLPANDSSGKSFID
LVLKSSEEDMKCWPYSFEFHLRVSLTTDGDLTLISRVRNINGKPFSFSFAYHTYLLVSDI
SEIRIEGLETLDYLDNLFQKERFTEQGDAITFESEVDRVYLSSPNIIAVLDHERKRTFVI
RKDGLPDVAVWNPWEKKSKSMSDFGDEEYKQMLCVDGAVIEKPVNLKPGEEWTGRLQLSI
VPSSFCSDHLGLDRSDL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggcattctgcagctgtgtgggactatagagcagcaactgaaattacaaaggactgg
aatggaattcatcaaattgtgcttcggactccaaggggtgcttcggcacaggtaagctta
catggggcgcaggtcacttcgtggcggaatgagcatggggaagaacttcttttcacaagc
agcaaggcaattttcaaggctccaaaagcaatacgaggaggaattcctatatgttttcca
cagttcggaaactgtggatcgctggaactgcatggttttgtgagaaatagaatgtgggca
attgatgataatcctcctcctctacctgcaaatgattctagtgggaaatccttcattgat
ctggtattaaaatcatctgaagaagatatgaagtgctggccatatagttttgaattccat
cttcgggtgtctcttacaacagatggggacctgactttgatatctagagtcaggaatata
aatggcaagccatttagtttctcatttgcatatcacacatacttattggtctctgacata
agtgagataaggattgaaggtctggagacactggattacctagacaaccttttccaaaag
gaacggtttacagaacaaggagatgcaataacatttgaatctgaggtggatcgagtgtat
cttagctctccaaacataattgcggtgctagatcatgagaggaaacgaacatttgttata
aggaaggatggtctccctgatgttgctgtgtggaatccatgggagaagaaatcaaaatca
atgtcagactttggtgatgaggagtataaacaaatgctttgtgttgatggggcagtaata
gagaaacctgtgaacttgaagccgggcgaggaatggactgggcggctgcagctctcgatt
gtgccgtcaagtttttgcagcgaccatctaggtctggacagaagtgatctttga

DBGET integrated database retrieval system